Loading...
Ph I ESA 37_049 and _062 Aug_6_2014    - $XJXVW         3UHSDUHG)RU  &LW\RI1RUWKDPSWRQ 3ODQQLQJDQG6XVWDLQDELOLW\'HSDUWPHQW 0DLQ6WUHHW5RRP 1RUWKDPSWRQ0DVVDFKXVHWWV       3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW $VVHVVRUV3DUFHOVDQG 5RFN\+LOO5GDQG(DVWKDPSWRQ5G 1RUWKDPSWRQ0DVVDFKXVHWWV              3UHSDUHG%\  2¶5HLOO\7DOERW 2NXQ$VVRFLDWHV,QF %ULGJH6WUHHW6XLWH 6SULQJILHOG0DVVDFKXVHWWV VV  [ASSOCIATES] (QYLURQPHQWDO6DIHW\+HDOWK*HRWHFKQLFDO 293BridgeStreet Suite500 Springfield,MA01103 Tel4137886222 Fax4137888830 www.otoͲenv.com - $XJXVW  &LW\RI1RUWKDPSWRQ 0DLQ6WUHHW5RRP 1RUWKDPSWRQ0DVVDFKXVHWWV  $WWHQWLRQ0U:D\QH)HLGHQ)$,&3 'LUHFWRURI3ODQQLQJDQG6XVWDLQDELOLW\  5H3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW $VVHVVRU¶V3DUFHOVDQG 5RFN\+LOO5RDGDQG(DVWKDPSWRQ5RDG 1RUWKDPSWRQ0DVVDFKXVHWWV  'HDU0U)HLGHQ  $WWDFKHGLVRXU3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW (6$ IRUSDUFHOVDQG LQ1RUWKDPSWRQ0DVVDFKXVHWWV2XU3KDVH,(6$ZDVSHUIRUPHGLQJHQHUDO DFFRUGDQFHZLWK$6706WDQGDUG3UDFWLFH(  2XUDVVHVVPHQWGLGQRWLGHQWLI\DQ\5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQVDWWKHVLWH  6KRXOG\RXKDYHDQ\TXHVWLRQVUHJDUGLQJWKHUHSRUWSOHDVHGRQRWKHVLWDWHWRFRQWDFW XV  9HU\WUXO\\RXUV 2¶5HLOO\7DOERW 2NXQ$VVRFLDWHV,QF    6DEULQD0RUHDX9DOHULH7LOOLQJKDVW/63 6WDII6FLHQWLVW$VVRFLDWH            2?-?&LW\RI1RUWKDPSWRQ?W?(6$5HSRUWGRF[ 7$%/(2)&217(176 (;(&87,9(6800$5< ,1752'8&7,21 385326( 6&23(2)6(59,&(6 6,*1,),&$17$668037,216 /,0,7$7,216$1'(;&(37,216 63(&,$/7(506$1'&21',7,216 86(55(/,$1&( 6,7('(6&5,37,21 /2&$7,21$1'/(*$/'(6&5,37,21 6,7($1'9,&,1,7<*(1(5$/&+$5$&7(5,67,&6 &855(1786(2)7+(6,7( '(6&5,37,2162)6758&785(652$'6$1',03529(0(176 &855(1786(62)$'-2,1,1*3523(57,(6 86(53529,'(',1)250$7,21 5(&25'65(9,(: 3+<6,&$/6(77,1*66285&(6 +,6725,&$/86(,1)250$7,21217+(6,7($1'$'-2,1,1*3523(57,(6 67$1'$5'(19,5210(17$/5(&25'66285&(6 $'',7,21$/(19,5210(17$/5(&25'66285&(6 6,7(5(&211$,66$1&( 0(7+2'2/2*<$1'/,0,7,1*&21',7,216 6,7(6(77,1*$1'2%6(59$7,216 ,17(59,(:6 ,17(59,(:6:,7+2:1(562&&83$1766,7(0$1$*(5 ,17(59,(:6:,7+/2&$/*29(510(17$*(1&,(6 ),1',1*6 23,1,21$1'&21&/86,216 '(9,$7,216 $'',7,21$/6(59,&(6 5()(5(1&(6 (19,5210(17$/352)(66,21$/67$7(0(17 48$/,),&$7,2162)(19,5210(17$/352)(66,21$/6  7$%/(6  7DEOH6WDQGDUG(QYLURQPHQWDO5HFRUGV6RXUFHV   ),*85(6  )LJXUH6LWH/RFXV )LJXUH6LWH6NHWFK   $33(1',&(6  $SSHQGL[$8VHU4XHVWLRQQDLUH $SSHQGL[%6LWH3KRWRJUDSKV $SSHQGL[&+LVWRULFDO'RFXPHQWV $SSHQGL['('55DGLXV0DS'DWDEDVH5HSRUW $SSHQGL[((3ULRULW\5HVRXUFH0DS $SSHQGL[)6LWH5HFRQQDLVVDQFH)RUP $SSHQGL[*2ZQHU,QWHUYLHZ)RUP        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  (;(&87,9(6800$5<  $3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQWIRUSURSHUW\ORFDWHGEHWZHHQ5RFN\+LOO5RDG DQG(DVWKDPSWRQ5RDGDWORWVDQGLQ1RUWKDPSWRQ0DVVDFKXVHWWVKDV EHHQFRQGXFWHGE\2¶5HLOO\7DOERW 2NXQ$VVRFLDWHV,QF 272 7KLVUHSRUWKDVEHHQ SUHSDUHGLQJHQHUDODFFRUGDQFHZLWKWKH$6706WDQGDUG()RUWKHSXUSRVHVRI WKLVDVVHVVPHQWWKHWHUP³6LWH´KDVEHHQXVHGWRUHIHUWRWKHORWVDQG 7KHDVVHVVPHQWFRQVLVWHGRIDUHFRUGVUHYLHZD6LWHDQGDUHDUHFRQQDLVVDQFH LQWHUYLHZVZLWK6LWHUHSUHVHQWDWLYHVDUHYLHZRIUHJXODWRU\DJHQF\ILOHLQIRUPDWLRQ LQWHUYLHZVZLWKORFDOJRYHUQPHQWRIILFLDOVDQGSUHSDUDWLRQRIWKLVUHSRUW$VXPPDU\RI RXUILQGLQJVLVSUHVHQWHGEHORZ  7KH6LWHFRQWDLQVWZRLUUHJXODUO\VKDSHGXQGHYHORSHGSDUFHOVZKLFKWRWDO DSSUR[LPDWHO\DFUHV7KH6LWHLVORFDWHGLQDUXUDOUHVLGHQWLDODUHDRI5RFN\+LOO5RDG 5RXWH DQGDUXUDOFRPPHUFLDODUHDDORQJ(DVWKDPSWRQ5RDG 5RXWH RI 1RUWKDPSWRQ0DVVDFKXVHWWV2QHDEDQGRQHGEXLOGLQJLVORFDWHGRQWKHQRUWKHUQ SRUWLRQRIWKH6LWH7KHEXLOGLQJKDVDQDSSUR[LPDWHO\IRRWE\IRRWIRRWSULQWDQGLV LQDFFHVVLEOHGXHWRERDUGVRYHUWKHZLQGRZVDQGGRRUV$JUDYHOFRYHUHGDFFHVVURDG H[WHQGVVRXWKHDVWRI5RFN\+LOO5RDGWRDODQGORFNHG3DUFHORZQHGE\7HQQHFR*DV &RPSDQ\2QWKLVSDUFHOWKHUHLVDFKDLQOLQNIHQFHGDUHDFRQWDLQLQJWZREXLOGLQJVZKLFK DUHSXPSKRXVHVIRUPDLQWDLQLQJSUHVVXUHLQWKHVXEVXUIDFHQDWXUDOJDVOLQHWKDW WUDQVHFWVWKHQRUWKZHVWHUQSRUWLRQRIWKH6LWH7KHSXPSLQJVWDWLRQSDUFHOLVQRWSDUWRI WKHVXEMHFW6LWH$QHDVHPHQWZLWKRYHUKHDGHOHFWULFWUDQVPLVVLRQOLQHVWUDQVHFWVWKH QRUWKHUQSRUWLRQVRIERWKSDUFHOV7KHSDUFHOVDUHGLYLGHGE\WKHQRUWKVRXWKRULHQWHG 0DQKDQ5DLO7UDLO7KHORWIURQWLQJ(DVWKDPSWRQ5RDG  KDVDQRUWKVRXWK RULHQWHGRYHUKHDGWUDQVPLVVLRQOLQHVWKDWWUDQVHFWWKHORW7KHUHPDLQLQJSRUWLRQVRIERWK ORWVDUHXQGHYHORSHGZRRGHGODQG  7KH(QYLURQPHQWDO'DWD5HVRXUFHVGDWDEDVHVHDUFKLGHQWLILHGUHOHDVHVZLWKLQWKH VHDUFKUDGLLIRUWKH6LWHEXWEDVHGRQGLVWDQFHIURPWKH6LWHUHJXODWRU\VWDWXVRIWKH UHOHDVHVDQGLQIHUUHGJURXQGZDWHUIORZGLUHFWLRQQRQHRIWKHVHDUHOLNHO\WRLPSDFW6LWH VRLODQGRUJURXQGZDWHUWRUHSRUWDEOHOHYHOV  7KH6LWHDFFHVVURDGSXPSLQJVWDWLRQDQGRYHUKHDGWUDQVPLVVLRQOLQHVZHUH FRQVWUXFWHGVRPHWLPHEHWZHHQDQG,QD6LWHEXLOGLQJNQRZQDV 6DQG\¶V6SHHG(TXLSPHQWRFFXSLHGWKHQRUWKHUQSRUWLRQRIWKH6LWHDW5RFN\+LOO 5RDG7KHSRUWLRQVRIWKH6LWHRWKHUWKDQHDVHPHQWVRU6DQG\¶V6SHHG(TXLSPHQW UHPDLQHGZRRGHGDQGXQGHYHORSHGIURPWKURXJK  7KHUHDUHQRUHFRUGVRUYLVXDOLQGLFDWLRQVRIFXUUHQWRUIRUPHUVWRUDJHWDQNVDWWKH6LWH  7KH6LWH5HFRQQDLVVDQFHZDVSHUIRUPHGRQ-XO\2XU6LWHYLVLWZDVSHUIRUPHG IROORZLQJJXLGHOLQHVLGHQWLILHGLQ6HFWLRQRI$6706WDQGDUG(:HREVHUYHG QRFRQGLWLRQVLQGLFDWLQJDUHSRUWDEOHUHOHDVHRUWKUHDWRIUHOHDVHFRQGLWLRQDWWKH6LWH  7KLVDVVHVVPHQWKDVUHYHDOHGQRHYLGHQFHRID5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ 5(& +LVWRULFDO5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ +5(& RU&RQWUROOHG 5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ &5(& LQFRQQHFWLRQZLWKWKHSURSHUW\WKDWZRXOG UHTXLUHIXUWKHUDFWLRQ         3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$    ,1752'8&7,21  385326(  7KLVUHSRUWSUHVHQWVWKHUHVXOWVRID3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW (6$  SHUIRUPHGIRUSDUFHOVDQGORFDWHGEHWZHHQ5RFN\+LOO5RDG 5RXWH  DQG(DVWKDPSWRQ5RDG 5RXWH LQ1RUWKDPSWRQ0DVVDFKXVHWWV)RUWKHSXUSRVHVRI WKLVDVVHVVPHQWWKHWHUP³6LWH´LVXVHGWRUHIHUWRWKHVHSDUFHOV7KLV3KDVH,(6$ZDV SHUIRUPHGLQJHQHUDODFFRUGDQFHZLWK$6706WDQGDUG3UDFWLFH(7KLVZRUN ZDVSHUIRUPHGDWWKHUHTXHVWRI0U:D\QH)HLGHQWKH'LUHFWRURI3ODQQLQJDQG 6XVWDLQDELOLW\IRUWKH&LW\RI1RUWKDPSWRQ  7KHSXUSRVHRIRXU3KDVH,(6$ZDVWRHYDOXDWHWKH6LWHKLVWRU\DQGFXUUHQWFRQGLWLRQV WRLGHQWLI\5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQV 5(&V KLVWRULFDO5HFRJQL]HG (QYLURQPHQWDO&RQGLWLRQV +5(&V RUFRQWUROOHG5HFRJQL]HG(QYLURQPHQWDO&RQGLWRQV &5(&V DWWKH6LWH  6&23(2)6(59,&(6  7RPHHWWKLVREMHFWLYHWKHIROORZLQJWDVNVZHUHXQGHUWDNHQ  x$5HFRUGV5HYLHZRI6WDQGDUG(QYLURQPHQWDO5HFRUGV6RXUFHV x$6LWHUHFRQQDLVVDQFH x,QWHUYLHZVZLWKWKH.H\6LWH0DQDJHU x,QWHUYLHZVZLWK/RFDO*RYHUQPHQW2IILFLDOVDQG x(YDOXDWLRQDQGUHSRUWSUHSDUDWLRQ  6,*1,),&$17$668037,216  2¶5HLOO\7DOERW 2NXQ$VVRFLDWHV,QF 272 KDVSHUIRUPHGWKHHQYLURQPHQWDOUHFRUG VHDUFKHVLQDFFRUGDQFHZLWKFXUUHQW$670DQGLQGXVWU\SUDFWLFH7KHGDWDILQGLQJV DQGFRQFOXVLRQVSUHVHQWHGLQWKLV3KDVH,(6$DUHEDVHGXSRQDVHDUFKUHYLHZDQG DQDO\VLVRIWKHGRFXPHQWVDQGLQWHUYLHZVDVZHOODVREVHUYDWLRQVPDGHGXULQJWKH6LWH UHFRQQDLVVDQFH&RQFOXVLRQVUHDFKHGUHJDUGLQJWKHFRQGLWLRQVRIWKH6LWHGRQRW UHSUHVHQWDZDUUDQW\WKDWDOODUHDVZLWKLQWKH6LWHDUHRIDVLPLODUTXDOLW\DVPD\EH LQIHUUHGIURPREVHUYDEOH6LWHFRQGLWLRQVDQGDYDLODEOH6LWHKLVWRU\$VVWDWHGLQWKH  $5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ 5(& LVWKHSUHVHQFHRUOLNHO\SUHVHQFHRIDQ\KD]DUGRXV VXEVWDQFHRUSHWUROHXPSURGXFWVLQRQRUDWDSURSHUW\  GXHWRUHOHDVHWRWKHHQYLURQPHQW  XQGHU FRQGLWLRQVLQGLFDWLYHRIDUHOHDVHWRWKHHQYLURQPHQWRU  XQGHUFRQGLWLRQVWKDWSRVHDPDWHULDOWKUHDWRID IXWXUHUHOHDVHWRWKHHQYLURQPHQW'HPLQLPLVFRQGLWLRQVDUHQRW5(&V +LVWRULFDO5(&VDUHSDVWUHOHDVHVRIDQ\KD]DUGRXVVXEVWDQFHRUSHWUROHXPSURGXFWWKDWKDVRFFXUUHGLQ FRQQHFWLRQZLWKWKHSURSHUW\DQGKDVEHHQDGGUHVVHGWRWKHVDWLVIDFWLRQRIWKHDSSOLFDEOHUHJXODWRU\ DXWKRULW\ZLWKRXWVXEMHFWLQJWKHSURSHUW\WRDQ\UHTXLUHGFRQWUROV VXFKDVDQ$FWLYLW\DQG8VH/LPLWDWLRQ  &RQWUROOHG5(&VUHVXOWIURPDSDVWUHOHDVHRIKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWVWKDWKDVEHHQ DGGUHVVHGWRWKHVDWLVIDFWLRQRIWKHDSSOLFDEOHUHJXODWRU\DXWKRULW\ IRUH[DPSOHDVHYLGHQFHGE\WKH LVVXDQFHRIDQRIXUWKHUDFWLRQOHWWHURUHTXLYDOHQWRUPHHWLQJULVNEDVHGFULWHULDHVWDEOLVKHGE\UHJXODWRU\ DXWKRULW\ ZLWKKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWVDOORZHGWRUHPDLQLQSODFHVXEMHFWWRWKH LPSOHPHQWDWLRQRIUHTXLUHGFRQWUROV VXFKDVDQ$FWLYLW\DQG8VH/LPLWDWLRQ         3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  $670VWDQGDUGQR(6$FDQZKROO\HOLPLQDWHXQFHUWDLQW\UHJDUGLQJSRWHQWLDO HQYLURQPHQWDOFRQGLWLRQVLQFRQQHFWLRQZLWKWKH6LWH272¶VHYDOXDWLRQDQGDQDO\VLVDUH LQWHQGHGWRUHGXFHQRWHOLPLQDWHWKHSRWHQWLDOIRUFRQGLWLRQVWKDWUHVXOWLQHQYLURQPHQWDO ULVNIRUWKHHQGXVHURIWKLV3KDVH,(6$  /,0,7$7,216$1'(;&(37,216  2XUUHSRUWKDVEHHQSHUIRUPHGVXEMHFWWRWKHIROORZLQJOLPLWDWLRQVDQGH[FHSWLRQV  7KHREVHUYDWLRQVSUHVHQWHGLQWKLVUHSRUWZHUHPDGHXQGHUWKHFRQGLWLRQV GHVFULEHGKHUHLQ7KHFRQFOXVLRQVSUHVHQWHGDUHEDVHGVROHO\XSRQWKHVHUYLFHV GHVFULEHGDQGQRWRQVFLHQWLILFWDVNVRUSURFHGXUHVEH\RQGWKHVFRSHRIWKH SURMHFW7KHZRUNGHVFULEHGLQWKLVUHSRUWZDVFDUULHGRXWLQDFFRUGDQFHZLWKWKH FRQWUDFW7HUPVDQG&RQGLWLRQV ,QSUHSDULQJWKHUHSRUW2 5HLOO\7DOERW2NXQ $VVRFLDWHV,QFUHOLHGRQFHUWDLQ LQIRUPDWLRQSURYLGHGE\IHGHUDOVWDWHDQGORFDORIILFLDOVDQGRWKHUSDUWLHV UHIHUHQFHGKHUHLQDQGRQLQIRUPDWLRQFRQWDLQHGLQWKHILOHVRIVWDWHRUORFDO UHJXODWRU\DJHQFLHVDWWKHWLPHRIWKHILOHUHYLHZ$OWKRXJKWKHUHPD\KDYHEHHQ VRPHGHJUHHRIRYHUODSLQWKHLQIRUPDWLRQSURYLGHGE\WKHVHVRXUFHV2 5HLOO\ 7DOERW2NXQ $VVRFLDWHV,QFGLGQRWDWWHPSWWRLQGHSHQGHQWO\YHULI\WKH DFFXUDF\RUFRPSOHWHQHVVRIDOOLQIRUPDWLRQUHYLHZHGRUUHFHLYHGGXULQJWKH FRXUVHRIWKLVDVVHVVPHQW 2EVHUYDWLRQVZHUHPDGHRIWKH6LWHDQGRIWKHVWUXFWXUHVRQWKH6LWHDVLQGLFDWHG ZLWKLQWKHUHSRUW:KHUHDFFHVVWRSRUWLRQVRIWKH6LWHRUWRVWUXFWXUHVRQWKH6LWH ZDVXQDYDLODEOHRUOLPLWHGZHUHQGHUQRRSLQLRQDVWRWKHSUHVHQFHRIKD]DUGRXV PDWHULDOVRURLORUWRWKHSUHVHQFHRILQGLUHFWLQIRUPDWLRQUHODWLQJWRKD]DUGRXV PDWHULDOVRURLOLQWKDWSRUWLRQRIWKH6LWH,QDGGLWLRQZHUHQGHUQRRSLQLRQDVWR WKHSUHVHQFHRIKD]DUGRXVPDWHULDOVRURLOZKHUHGLUHFWREVHUYDWLRQVRISRUWLRQV RIWKH6LWHZHUHREVWUXFWHGE\REMHFWVRUFRYHULQJVRQRURYHUWKHVHVXUIDFHV 7KHSXUSRVHRIWKLV5HSRUWZDVWRDVVHVVWKHSK\VLFDOFKDUDFWHULVWLFVRIWKH6LWH ZLWKUHVSHFWWRWKHSUHVHQFHRIKD]DUGRXVPDWHULDORURLOLQVRLORUJURXQGZDWHUDW WKH6LWH1RVSHFLILFDWWHPSWZDVPDGHWRFKHFNRQWKHFRPSOLDQFHRISUHVHQWRU SDVWRZQHUVRURSHUDWRUVRIWKH6LWHZLWKIHGHUDOVWDWHRUORFDOODZVDQG UHJXODWLRQVHQYLURQPHQWDORURWKHUZLVH  63(&,$/7(506$1'&21',7,216  7KHUHDUHQRRWKHUVSHFLDOWHUPVRUFRQGLWLRQVFRQFHUQLQJWKLVSURMHFWRWKHUWKDQWKRVH VSHFLILFDOO\GHVFULEHGLQ6HFWLRQ6FRSHRI6HUYLFHV  86(55(/,$1&(  7KLVUHSRUWGRFXPHQWVWKH3KDVH,(6$RIWKH6LWHSHUIRUPHGE\272DWWKHUHTXHVWRI WKH&LW\RI1RUWKDPSWRQDQGLQDFFRUGDQFHZLWK$6707KHILQGLQJVRSLQLRQV DQGFRQFOXVLRQVRIWKLV3KDVH,(6$DUHIRUWKHFRQILGHQWLDODQGH[FOXVLYHXVHRIWKH&LW\ RI1RUWKDPSWRQ5HOLDQFHRQWKLVUHSRUWIRUDQ\XVHE\SDUWLHVRWKHUWKDQVSHFLILFDOO\ VWDWHGLVSURKLELWHGZLWKRXWWKHH[SUHVVZULWWHQFRQVHQWRI272DQGVXFKXVHLVDWWKH VROHULVNRIWKHXVHU$Q$670(IRUPDWWHGXVHUTXHVWLRQQDLUHFRPSOHWHGE\        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  WKHXVHURIWKHUHSRUW0U:D\QH)HLGHQUHSUHVHQWDWLYHRIWKH&LW\RI1RUWKDPSWRQLV DWWDFKHGLQ$SSHQGL[$  6,7('(6&5,37,21  ,QIRUPDWLRQLQWKLVVHFWLRQFRPHVSULPDULO\IURPWKH6LWHUHFRQQDLVVDQFHDQGUHFRUGV REWDLQHGIURPWKH&LW\RI1RUWKDPSWRQ$VVHVVRU¶V2IILFH'HWDLOVRIWKHUHFRQQDLVVDQFH DQGLQWHUYLHZVDUHLQFRUSRUDWHGLQWRWKLVUHSRUWZKHUHDSSURSULDWH$6LWHYLFLQLW\PDS 6LWH/RFXV DQGD6LWH6NHWFKDUHDWWDFKHGDV)LJXUHVDQGUHVSHFWLYHO\ 3KRWRJUDSKVRIWKH6LWHDUHSURYLGHGLQ$SSHQGL[% /2&$7,21$1'/(*$/'(6&5,37,21  $6LWH/RFXVEDVHGRQWKHFXUUHQW8QLWHG6WDWHV*HRORJLFDO6XUYH\ 86*6  WRSRJUDSKLFPDSRIWKH(DVWKDPSWRQ0DVVDFKXVHWWV4XDGUDQJOHLVDWWDFKHGDV)LJXUH 7KH6LWHLVFRPSULVHGRIWZRSDUFHOVLGHQWLILHGLQ1RUWKDPSWRQ$VVHVVRUVUHFRUGVDV ORWVDQG$6LWH6NHWFKLVSURYLGHGDV)LJXUH  6,7($1'9,&,1,7<*(1(5$/&+$5$&7(5,67,&6  7KH6LWHFRQWDLQVWZRZRRGHGXQGHYHORSHGORWVZLWKRYHUKHDGWUDQVPLVVLRQOLQH HDVHPHQWV2QHORWLVORFDWHGDW5RFN\+LOO5RDGDQGLWLVLGHQWLILHGDVORW 7KLVORWLVDQLUUHJXODUO\VKDSHGDSSUR[LPDWHO\DFUHORW7KLVORWKDVD7HQQHVVHH *DV 7HQQHFR HDVHPHQWDVZHOODVDODQGORFNHGSDUFHO  RZQHGE\7HQQHFR *DV$QDSSUR[LPDWHO\IRRWORQJJUDYHOURDGIURP5RFN\+LOO5RDGDFFHVVHVD IRRWE\IRRWIHQFHGDUHDZLWKWZRSXPSKRXVHEXLOGLQJVXVHGE\7HQQHFR*DVDQG %HUNVKLUH*DV7KHVHFRQG6LWHORWORFDWHGDORQJ(DVWKDPSWRQ5RDGLVDURXJKO\ WULDQJXODUDSSUR[LPDWHO\DFUHDUHDLGHQWLILHGDVORW7KHORWVDUHVHSDUDWHG E\WKHQRUWKVRXWKRULHQWHG0DQKDQ5DLO7UDLO ELNHSDWK 7KH6LWHLVORFDWHGLQDUXUDO DUHDEHWZHHQ5RFN\+LOO5RDGDQG(DVWKDPSWRQ5RDGLQ1RUWKDPSWRQ0DVVDFKXVHWWV  6LWHWRSRJUDSK\UDQJHVIURPDSSUR[LPDWHO\IHHWDERYH0HDQ6HD/HYHO 06/ LQWKH ZHVWHUQSRUWLRQRIWKH6LWHWRDSSUR[LPDWHO\IHHWDERYH06/LQWKHHDVWHUQSRUWLRQRI WKH6LWH7RSRJUDSK\JHQHUDOO\VORSHVGRZQIURPWKHZHVWWRWKHQRUWKHDVWDQGHDVW 7KHQHDUHVWVXUIDFHZDWHUERG\LVDQHDVWHUO\IORZLQJXQQDPHGVWUHDPORFDWHGDORQJ WKHQRUWKHUQSURSHUW\ERXQGDU\7KLVVWUHDPGUDLQV5RFN\+LOO3RQGWKDWLVORFDWHGQRUWK RI5RFN\+LOO5RDGRSSRVLWHWKH6LWH7KHVWUHDPGLVFKDUJHVLQWRWKHZHWODQGQDPHG 3\FKRQ0HDGRZVZKLFKVXUURXQGVWKHVRXWKHUO\IORZLQJ0LOO5LYHU%DVHGXSRQUHJLRQDO WRSRJUDSK\JURXQGZDWHUIORZGLUHFWLRQEHQHDWKWKH6LWHLVOLNHO\LQDVRXWKHDVWHUO\ GLUHFWLRQWRZDUGVWKH0LOO5LYHU1RVXEVXUIDFHH[SORUDWLRQVZHUHFRQGXFWHGE\272WR FRQILUPWKHLQIHUUHGJURXQGZDWHUIORZGLUHFWLRQ  3UHFLSLWDWLRQDWWKH6LWHZRXOGOLNHO\LQILOWUDWHLQWRWKHJURXQGVXUIDFH  &855(1786(2)7+(6,7(  $VGHVFULEHGLQ6HFWLRQWKH6LWHLVSULPDULO\XQGHYHORSHGZRRGHGODQG$JUDYHO DFFHVVURDGLVSUHVHQWLQWKHQRUWKHUQSRUWLRQRIWKHSURSHUW\7KHURDGH[WHQGVWRWKH FHQWUDOSRUWLRQRIWKH6LWHZKHUHWKHUHLVDODQGORFNHGSDUFHORZQHGE\7HQQHFR*DV        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  &RPSDQ\FRQWDLQLQJDIHQFHGDUHDZLWKDEXLOGLQJFRQWDLQLQJDQDWXUDOJDVSLSHOLQH SXPSKRXVH$EXWWLQJWKLVDUHDLVDVHFRQGIHQFHGDUHDFRQWDLQLQJDEXLOGLQJRFFXSLHG E\%HUNVKLUH*DV&RPSDQ\2YHUKHDGWUDQVPLVVLRQOLQHVH[WHQGDORQJWKHQRUWKHUQ SRUWLRQVRIWKH6LWHDQGVPDOOHUWUDQVPLVVLRQOLQHVFURVVORWRULHQWHGQRUWKVRXWK  '(6&5,37,2162)6758&785(652$'6$1',03529(0(176  6HFWLRQGHVFULEHGWKHVWUXFWXUHVURDGVDQGLPSURYHPHQWVDWWKH6LWH  &855(1786(62)$'-2,1,1*3523(57,(6  7KH6LWHLVDEXWWHGE\RSHQILHOGVWRWKHQRUWKUHVLGHQWLDOSURSHUWLHVWRWKHQRUWKZHVW 3LQH*URYH*ROI&RXUVH :LOVRQ5RDG WRDQGVRXWKZHVWXQGHYHORSHGZRRGHGODQG WRWKHVRXWK(DVWKDPSWRQ5RDGIROORZHGE\9DOOH\5HF\FOLQJDQG7UDQVIHU)DFLOLW\  (DVWKDPSWRQ5RDG WRWKHHDVWDQG5LFKDUG¶V)XHO,QFIROORZHGE\3KLOOLSV(QWHUSULVHV (DVWKDPSWRQ5RDG WRWKHQRUWKHDVW  86(53529,'(',1)250$7,21  $XVHUTXHVWLRQQDLUH DVUHIHUHQFHGLQWKH$6706WDQGDUG ZDVFRPSOHWHGE\WKHFOLHQW WKH&LW\RI1RUWKDPSWRQ7KHFRQWDFW0U:D\QH)HLGHQ'LUHFWRURI3ODQQLQJDQG 6XVWDLQDELOLW\FRPSOHWHGWKHTXHVWLRQQDLUH$FRS\RIWKHXVHUTXHVWLRQQDLUHLVDWWDFKHG LQ$SSHQGL[$5HOHYDQWLQIRUPDWLRQLVLQFOXGHGLQVHFWLRQVWKURXJKRXWWKLVUHSRUW  5(&25'65(9,(: 3+<6,&$/6(77,1*66285&(6  7KH8QLWHG6WDWHV*HRORJLFDO6XUYH\ 86*6 WRSRJUDSKLFPDSRIWKH(DVWKDPSWRQ 0DVVDFKXVHWWV4XDGUDQJOHZDVUHYLHZHGDQGXVHGWRSUHSDUHWKH6LWH/RFXV )LJXUH   7KH86*6PDSRIWKH6LWHYLFLQLW\LVWKHRQO\SK\VLFDOVHWWLQJVRXUFHUHTXLUHGWREH UHYLHZHGE\WKH$6706WDQGDUG1RRWKHUSK\VLFDOVHWWLQJVRXUFHVZHUHUHYLHZHG  +,6725,&$/86(,1)250$7,21217+(6,7($1'$'-2,1,1* 3523(57,(6  ,QIRUPDWLRQZDVFROOHFWHGE\272IURPWKH1RUWKDPSWRQ$VVHVVRU¶V2IILFH+HDOWK 'HSDUWPHQW)LUH'HSDUWPHQWDQGRQOLQHIURP0DVV'(3¶VOLVWRIUHJLVWHUHGZHOOV 6SHFLILFUHVRXUFHVUHYLHZHGE\272WKURXJK(QYLURQPHQWDO'DWD5HVRXUFHV ('5  UHSRUWVZHUHKLVWRULFDHULDOSKRWRJUDSKVKLVWRULFWRSRJUDSKLFPDSVKLVWRULFVWUHHW GLUHFWRULHVDQG&HUWLILHG6DQERUQ)LUH,QVXUDQFH0DSV*35LGHQWLILHGWKDW6DQERUQ)LUH ,QVXUDQFH0DSVZHUHQRWDYDLODEOHIRUWKH6LWHYLFLQLW\7KHRZQHURIWKH6LWH0V&DURO +HZHVZDVLQWHUYLHZHGRQ-XO\&RSLHVRIKLVWRULFDOGRFXPHQWVDUHDWWDFKHG LQ$SSHQGL[&            3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  $VVHVVRUV  7KH1RUWKDPSWRQ$VVHVVRUVLQIRUPDWLRQZDVFROOHFWHGRQOLQHRQ-XO\DW KWWSZZZQRUWKDPSWRQDVVHVVRUXVE\272IRUORWVDQG7KHODQGDUHD RIWKHFRPELQHGSDUFHOVLVDSSUR[LPDWHO\DFUHV7KHFDUGLQGLFDWHGWKHUHLVD VTXDUHIRRWEXLOGLQJZLWKDQDWWDFKHGVKHGORFDWHGRQORWFRQVWUXFWHGLQ 7KH³XWLOLWLHV´HQWU\IRUWKLVSDUFHOLV³DOOSXEOLF´1REXLOGLQJVZHUHLGHQWLILHGRQORW 7KHUHLVDQDFFHVVHDVHPHQWIURP5RFN\+LOO5RDGWRDODQGORFNHGSDUFHO LGHQWLILHGDVORW7KLVORWFRQWDLQVDEXLOGLQJDQGDSXPSKRXVHIRUWKHQDWXUDO JDVSLSHOLQHWKDWKDVDQHDVHPHQWWKURXJKWKHQRUWKHUQSRUWLRQRIWKH6LWH  +HDOWK'HSDUWPHQW  :HYLVLWHGWKH1RUWKDPSWRQ+HDOWK'HSDUWPHQWRQ-XO\+HDOWK'HSDUWPHQW SHUVRQQHOSURYLGHGDOLVWRINQRZQSULYDWHZHOOVDQGDPDSRIVRPHRIWKHNQRZQSULYDWH ZHOODUHDV&RSLHVRIWKHOLVWDQGPDSDUHDWWDFKHGLQ$SSHQGL[&$VLQGLFDWHGRQERWK WKHUHDUHNQRZQSULYDWHZHOOVORFDWHGZLWKLQIHHWRIWKH6LWH7KHNQRZQPDSSHG ZHOOVDUHVKRZQRQWKHHDVWVLGHRI(DVWKDPSWRQ5RDGLQWKHYLFLQLW\RI9DOOH\5HF\FOLQJ D7UDQVIHU)DFLOLW\DW(DVWKDPSWRQ5RDG7KLVDGGUHVV (DVWKDPSWRQ5RDG  ZDVLQFOXGHGLQWKHZHOOOLVWLQJDVDSURSHUW\ZLWKDZHOO7ZRRWKHUSRWHQWLDOZHOOVZHUH PDSSHGDORQJWKHHDVWHUQVLGHRI2OG:LOVRQ5RDGWRWKHZHVWRIWKH6LWH2QHZDVLQ WKHYLFLQLW\RI2OG:LOVRQ5RDGDQGWKHVHFRQGZDVORFDWHGLQWKHJHQHUDOYLFLQLW\RI 2OG:LOVRQ5RDG 3LQH*URYH*ROI&RXUVH 7KHPDSSHGSRWHQWLDOZHOOORFDWHGDW 2OG:LOVRQ5RDGZDVDOVRRQWKHZHOOOLVWLQJZRUNVKHHW  0DVV'(36HDUFK:HOO/LVW  0DVV'(3¶VRQOLQHVHDUFKDEOHZHOOGDWDEDVHZDVUHYLHZHGRQ-XO\2QWKLVOLVW (DVWKDPSWRQ5RDG2OG:LOVRQ5RDGDQG2OG:LOVRQ5RDGZHUHLGHQWLILHG DVSURSHUWLHVFRQWDLQLQJZHOOV7KHZHOOFRPSOHWLRQUHSRUWVIRUHDFKRIWKHVHZHOOVZHUH UHYLHZHGDQGDUHDWWDFKHGLQ$SSHQGL[&,WDSSHDUVWKHZHOOORFDWHGDW (DVWKDPSWRQ5RDGLVDLQFKGLDPHWHU39&UHFRYHU\ZHOOZLWKDWRWDOGHSWKRIIHHW EHORZJUDGH%DVHGRQWKLVLWDSSHDUVLWLVQRWDGULQNLQJZDWHUVXSSO\ZHOO7KHRWKHU ZHOOVDUHOLVWHGDVLQFKGLDPHWHUVWHHOGRPHVWLFZHOOVWKDWZHUHGHYHORSHGDQG GLVLQIHFWHGXSRQLQVWDOODWLRQ7KHZHOODW2OG:LOVRQ5RDGZDVLQVWDOOHGLQWRD WRWDOGHSWKRIIHHWEHORZJUDGHDQGWKHUHZDVDSHUPLWREWDLQHGIURPWKH 1RUWKDPSWRQ%RDUGRI+HDOWK7KHZHOODW2OG:LOVRQ5RDGZDVLQVWDOOHGLQWR DWRWDOGHSWKRIIHHWEHORZJUDGH7KHVHWZRZHOOVDUHSUHVXPHGWREHGULQNLQJ ZDWHUVXSSO\ZHOOV  )LUH'HSDUWPHQW  7KH1RUWKDPSWRQ)LUH'HSDUWPHQWZDVYLVLWHGRQ-XO\E\272SHUVRQQHO $VVLVWDQW)LUH&KLHI'XDQH1LFKROVLQGLFDWHGWKHILUHGHSDUWPHQWGLGQRWKDYHUHFRUGVRI FXUUHQWRUIRUPHUXQGHUJURXQGVWRUDJHWDQNV 867V DWWKH6LWHSDUFHOV7KHUHZHUHILOHV IRUVWRUDJHWDQNVDWWKUHHQHDUE\ORFDWLRQV5LFKDUGV)XHO,QFRQWKHZHVWVLGHRI (DVWKDPSWRQ5RDGWRWKHQRUWKHDVWRIWKH6LWHKDGUHFRUGVRIWKHUHPRYDORIWKUHH JDOORQ867VLQ2FWREHURI3KLOOLSV(QWHUSULVHVORFDWHGRQWKHHDVWVLGHRI (DVWKDPSWRQ5RDGDW(DVWKDPSWRQ5RDGKDGUHFRUGVIRUWKHUHPRYDORID JDOORQDERYHJURXQGVWRUDJHWDQN $67 LQ2FWREHURIDQGDQRWKHUJDOORQ$67        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  LQ$SULO7KH9DOOH\5HF\FOLQJDQG7UDQVIHU)DFLOLW\ DND3$OOHQ 6RQVDQG 1RUWKDPSWRQ7UDQVIHU6WDWLRQ ORFDWHGRQWKHHDVWVLGHRI(DVWKDPSWRQ5RDG LPPHGLDWHO\HDVWRIWKH6LWHKDGUHFRUGVIRUWKHLQVWDOODWLRQRIDJDOORQ867LQ DQGDJDOORQ867LQ%RWKRIWKHVHWDQNVKDGUHPRYDOGRFXPHQWVIURP 7KHUHZDVDOVRDSHUPLWIRUUHPRYDORIDJDOORQ$67LQ'HFHPEHU$ VNHWFKIURPLQGLFDWHGDSULYDWHZHOOIRUWKDWSURSHUW\LVORFDWHGHDVWRIWKHKRXVH &RSLHVRIWKHVHGRFXPHQWVDUHDWWDFKHGLQ$SSHQGL[&  +LVWRULF7RSRJUDSKLF0DSV  +LVWRULFWRSRJUDSKLFPDSVDUHGRFXPHQWHGLQDQ('5UHSRUWGDWHG-XO\DQG SURYLGHGLQ$SSHQGL['0DSVIURPDQGVKRZHGWKH6LWHRQWKHPLQXWH PDSRIWKH1RUWKDPSWRQ0DVVDFKXVHWWV4XDGUDQJOH7KHPDSVKRZLQJWKH6LWHIURP ZDVDPLQXWHPDSRIWKH+RO\RNH0DVVDFKXVHWWV4XDGUDQJOH0DSVRIWKH6LWH GDWHGDQGZHUHPLQXWHPDSVRIWKH(DVWKDPSWRQ 0DVVDFKXVHWWV4XDGUDQJOH7KHPDSVLQGLFDWHWKDWWKH6LWHDFFHVVURDGEXLOGLQJDQG WKHRYHUKHDGWUDQVPLVVLRQOLQHVZHUHFRQVWUXFWHGVRPHWLPHEHWZHHQDQG 7KHPDSVVKRZWKH6LWHYLFLQLW\EHFDPHPRUHGHYHORSHGDORQJH[LVWLQJURDGZD\VRYHU WLPH$OVRGHYHORSHGEHWZHHQDQGZHUHWZRFLUFXODUVWUXFWXUHVRQ (DVWKDPSWRQ5RDGMXVWQRUWKRIWKH6LWH7KH\DUHORFDWHGLQWKHVDPHORFDWLRQDVWKH FXUUHQWFLUFXODUVWUXFWXUHLGHQWLILHGDVDQDERYHJURXQGKHDWLQJRLOVWRUDJHWDQN  +LVWRULF$HULDO3KRWRJUDSKV  +LVWRULFDHULDOSKRWRJUDSKVDUHGRFXPHQWHGLQDQ('55HSRUWSURYLGHGWR272RQ-XO\ 3KRWRJUDSKVSURYLGHGZHUHIURP DQG7KHSKRWRJUDSKVKRZHGWKH6LWHDFFHVVURDGSXPSKRXVHDQG WKHRYHUKHDGWUDQVPLVVLRQOLQHV,QWKHWZRFLUFXODUVWUXFWXUHVQRWHGRQWKH WRSRJUDSKLFPDSVDUHYLVLEOHDQGDSSHDUWREHODUJHDERYHJURXQGVWRUDJHWDQNV7KH SKRWRJUDSKVKRZVRQHFLUFXODUDERYHJURXQGVWRUDJHWDQN6LQFHWKH6LWH DQG6LWHYLFLQLW\DSSHDUVLPLODUWRFXUUHQWFRQGLWLRQV)URPWRLWDSSHDUVWKH 0DQKDQ5DLO7UDLOEULGJHRYHU(DVWKDPSWRQ5RDGZDVFRPSOHWHG  +LVWRULF6WUHHW'LUHFWRULHV  :HUHYLHZHGKLVWRULFVWUHHWGLUHFWRU\OLVWLQJVIURP DQGIRU(DVWKDPSWRQ5RDGDQG5RFN\+LOO5RDG  6DQG\¶V$XWR6DOHVDQGRU6DQG\¶V6SHHG(TXLSPHQW DXWRSDUWV ZHUHOLVWHGDW 5RFN\+LOO5RDGLQDQG1RLQIRUPDWLRQZDVDYDLODEOHRQWKLV DGGUHVVLQWKHGLUHFWRU\  $SXPSLQJVWDWLRQLVOLVWHGDVEHLQJRIIRI5RFN\+LOO5RDGLQDQG  7KHUHZHUHQROLVWLQJVIRUWKH6LWHSURSHUW\DORQJ(DVWKDPSWRQ5RDG  $EXWWHUVRQ5RFN\+LOO5RDGDSSHDUWREHUHVLGHQWLDOSURSHUWLHV,QDSURSHUW\WR WKHQRUWKRIWKH6LWHDW(DVWKDPSWRQ5RDGZDVOLVWHGDV1RUZRRG,FH,QDQG (DVWKDPSWRQ5RDGZDVOLVWHGDVDEXLOGLQJFRPSDQ\)URPWR (DVWKDPSWRQ5RDGZDVOLVWHGDV3KLOOLSV(QWHUSULVHV/DQGWRWKHHDVWRIWKH6LWHRQ        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  WKHRSSRVLWHVLGHRI(DVWKDPSWRQ5RDGZDVOLVWHGDVWKH&LW\'XPSIURPWKURXJK ,QWKLVODQGZDVOLVWHGDV(DVWKDPSWRQ5RDGDV7RPUD(DVW 1RUWKDPSWRQ0DVV)DFLOLW\,Q(DVWKDPSWRQ5RDGZDVOLVWHGDV9DOOH\ 5HF\FOLQJ)URPWKURXJKODQGWRWKHVRXWKRI9DOOH\5HF\FOLQJDSSHDUHGWR EHUHVLGHQWLDO  2ZQHU,QWHUYLHZ  7KH6LWHRZQHU0UV&DURO+HZHVZDVLQWHUYLHZHGWKURXJKKHUDWWRUQH\RQ-XO\ 6KHLQGLFDWHGWKH6LWHLVSULPDULO\XQGHYHORSHGODQG7KHUHDUHHDVHPHQWVIRU XQGHUJURXQGQDWXUDOJDVDQGRYHUKHDGHOHFWULFXWLOLWLHVDWWKH6LWH6KHUHSRUWHGVKHKDV QRNQRZOHGJHRIDQ\SDVWHQYLURQPHQWDOUHSRUWVRUSHUPLWVFXUUHQWRUIRUPHU$67VRU 867VVSLOOVRUUHOHDVHVRUVWRUDJHRUXVHRISHWUROHXPSURGXFWVRUKD]DUGRXVPDWHULDOV DWWKH6LWH  6XPPDU\  ,QVXPPDU\WKH6LWHDFFHVVURDGSXPSLQJVWDWLRQDQGRYHUKHDGWUDQVPLVVLRQOLQHV ZHUHFRQVWUXFWHGVRPHWLPHEHWZHHQDQG,QDWHQIRRWE\WHQIRRW6LWH EXLOGLQJZDVFRQVWUXFWHGDW5RFN\+LOO5RDG7KHEXLOGLQJDSSHDUVWRKDYHEHHQ RFFXSLHGE\6DQG\¶V$XWR6DOHVDQGRU6DQG\¶V6SHHG(TXLSPHQWXQWLODWOHDVW 7KHSRUWLRQVRIWKH6LWHRWKHUWKDQXWLOLW\HDVHPHQWVRU6DQG\¶V6SHHG(TXLSPHQW UHPDLQHGZRRGHGDQGXQGHYHORSHGIURPWKURXJK  67$1'$5'(19,5210(17$/5(&25'66285&(6  7KH6WDQGDUG(QYLURQPHQWDO5HFRUGV6RXUFHVLGHQWLILHGLQWKH$6706WDQGDUGZHUH UHYLHZHGIRUWKH6LWHDQGYLFLQLW\XVLQJDQ('5GDWDEDVHVHDUFK$FRS\RIWKHUHFRUGV UHYLHZHGE\('5DQGWKHUDGLXVIRUZKLFKWKHVHDUFKZDVFRQGXFWHGLVVXPPDUL]HGLQ 7DEOH7KHUDGLXVVHDUFKHGIRUWKHVHGDWDEDVHVPHHWVRUH[FHHGVWKHUDGLXVUHTXLUHG LQWKH$670VWDQGDUG$FRS\RIWKH('5UHSRUWLVDWWDFKHGLQ$SSHQGL['  1RUHOHDVHVRUGDWDOLVWLQJVZHUHLGHQWLILHGIRUWKH6LWHSDUFHOV  1R)HGHUDO13/ 1DWLRQDO3ULRULWLHV/LVWRU6XSHUIXQG RU(3$%URZQILHOGRUIHGHUDOO\ OLVWHG&(5&/,6ORFDWLRQVZHUHLGHQWLILHGIRUWKH6LWHRUZLWKLQWKHVHDUFKUDGLL  $WRWDORIUHOHDVHVDQGRUUHJXODWRU\GDWDOLVWLQJVZHUHLGHQWLILHGZLWKLQWKHUHIHUHQFHG VHDUFKUDGLL5HOHDVHVORFDWHGZLWKLQDTXDUWHUPLOHRIWKH6LWHZHUHUHYLHZHG2QH UHOHDVHDQGRQHFORVHGODQGILOOZHUHLGHQWLILHGZLWKLQWKLVUDGLXV,QIRUPDWLRQRQWKHVH OLVWLQJVLVVXPPDUL]HGEHORZ  +DPSVKLUH&RXQW\-DLO 5RFN\+LOO5RDG  7KHQHDUHVWLGHQWLILHGUHOHDVHWRWKH6LWHZDVWKH+DPSVKLUH&RXQW\-DLOORFDWHGDW 5RFN\+LOO5RDG$OWKRXJKWKH('5UHSRUWOLVWVLWDVDKDOIPLOHQRUWKZHVWRIWKH6LWHWKH MDLOLVDFWXDOO\ORFDWHGLPPHGLDWHO\QRUWKRIWKH6LWHDFURVV5RFN\+LOO5RDG7KLV UHOHDVHZDVDVXGGHQUHOHDVHRIJDOORQVRIGLHVHOIXHOIURPDYHKLFOHLQ,WLV LGHQWLILHGE\0DVV'(3¶V5HOHDVH7UDFNLQJ1XPEHU 571 7KHUHOHDVHKDV        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  DFKLHYHGUHJXODWRU\FORVXUHE\VXEPLWWLQJD&ODVV$5HVSRQVH$FWLRQ2XWFRPH 5$2 $&ODVV$5$2PHDQVUHVSRQVHDFWLRQVDWWKH6LWHZHUHFRQGXFWHGWR DGGUHVVWKHUHOHDVHFRQGLWLRQWKHUHLV1R6LJQLILFDQW5LVNDQGFRQWDPLQDWLRQDWWKH SURSHUW\ZDVUHGXFHGWREDFNJURXQGFRQFHQWUDWLRQV%DVHGRQUHJXODWRU\VWDWXVDQG GLVWDQFHWRWKH6LWHWKLVUHOHDVHLVXQOLNHO\WRLPSDFW6LWHVRLODQGRUJURXQGZDWHUWR DERYHUHSRUWDEOHFRQFHQWUDWLRQV  7KH+DPSVKLUH&RXQW\-DLOZDVDOVROLVWHGDVDYHU\VPDOOTXDQWLW\5&5$JHQHUDWRURI RLORUKD]DUGRXVZDVWHDQGD5&5$1RQ*HQHUDWRURIKD]DUGRXVZDVWHDVDKDQGOHU /LVWLQJDVD5&5$JHQHUDWRURIKD]DUGRXVZDVWHRUD6:/GRHVQRWLQGLFDWHWKDWD UHOHDVHKDVRFFXUUHG  9DOOH\5HF\FOLQJDQG7UDQVIHU6WDWLRQ (DVWKDPSWRQ5RDG  9DOOH\5HF\FOLQJDQG7UDQVIHU6WDWLRQZKLFKLVORFDWHGDWHDVWRIWKH6LWHRQWKH RSSRVLWHVLGHRI(DVWKDPSWRQ5RDGZDVLGHQWLILHGDVD5&5$JHQHUDWRUDQGDVD PXQLFLSDOVROLGZDVWHODQGILOO7KHOLVWLQJVIRUWKLVODQGILOOLQGLFDWHWKDWLWLVDQXQOLQHG ODQGILOODFWLYHEHWZHHQDQGDQGWKDWLWZDVFORVHGLQ  $'',7,21$/(19,5210(17$/5(&25'66285&(6  ,QIRUPDWLRQLQWKLVVHFWLRQZDVREWDLQHGIURPWKH0DVV'(3RQOLQHUHSRUWDEOHUHOHDVHV ORRNXS0DVV'(3RQOLQHSULRULW\UHVRXUFH ( *,6PDSDQG(QYLURQPHQWDO 3URWHFWLRQ$JHQF\ (3$ UDGRQ]RQHPDSV  0DVV'(35HSRUWDEOH5HOHDVHV2QOLQHORRNXSDQG)LOH5HYLHZ  2Q-XO\WKH0DVV'(3RQOLQHUHSRUWDEOHUHOHDVHVORRNXSDYDLODEOHDW KWWSGEVWDWHPDXVGHSFOHDQXSVLWHVVHDUFKDVSZDVUHYLHZHGE\2727KHVHDUFK UHVXOWHGLQWKHLGHQWLILFDWLRQRIWKHDERYHPHQWLRQHGUHOHDVHDW5RFN\+LOO5RDG1R DGGLWLRQDOUHOHDVHVZHUHLGHQWLILHGLQWKHYLFLQLW\RIWKH6LWH  0DVV'(32QOLQH3ULRULW\5HVRXUFHV  7KH0DVV'(3RQOLQHSULRULW\UHVRXUFH ( *,6PDSRIWKH6LWHDQGYLFLQLW\ZDV UHYLHZHGRQ-XO\7KHQRUWKHUQSRUWLRQRI/RWDQGWKHHQWLUH/RW DUHPDSSHGDVHVWLPDWHGKDELWDWIRUUDUHZHWODQGZLOGOLIH7KHHDVWHUQSRUWLRQ OHVVWKDQ DFUH RI/RWLVPDSSHGDVDPHGLXP\LHOGDTXLIHU7KHRSHQILHOGDEXWWLQJWKH 6LWHWRWKHQRUWKLVPDSSHGDVSURWHFWHGRSHQVSDFHDQGLWLVHVWLPDWHGKDELWDWIRUUDUH ZHWODQGZLOGOLIH  $VROLGZDVWHODQGILOOLVVKRZQLQWKHDUHDRI9DOOH\5HF\FOLQJDQG7UDQVIHU6WDWLRQ ORFDWHGHDVWRIWKH6LWHRQWKHRSSRVLWHVLGHRI(DVWKDPSWRQ5RDG$FRS\RIWKH( 3ULRULW\5HVRXUFHPDSLVDWWDFKHGLQ$SSHQGL[(7KHPDSSHGOLPLWVRIWKHODQGILOOGRQRW H[WHQGRQWRWKH6LWH  7KH0DVVDFKXVHWWV&RQWLQJHQF\3ODQ 0&3 KDVHVWDEOLVKHGUHSRUWLQJFODVVLILFDWLRQV IRUSRWHQWLDOUHOHDVHVWRVRLODQGJURXQGZDWHU*URXQGZDWHUORFDWHGZLWKLQFXUUHQWRU        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  SRWHQWLDOGULQNLQJZDWHUVRXUFHDUHDVLVFODVVLILHGDV5&*:&XUUHQWGULQNLQJZDWHU VRXUFHDUHDVDUHGHILQHGDVDUHDV  x:LWKLQD=RQH,,RU,QWHULP:HOOKHDG3URWHFWLRQ$UHDIRUDSXEOLFZDWHUVXSSO\ x:LWKLQWKH=RQH$RID&ODVV$VXUIDFHZDWHUERG\XVHGDVDSXEOLFZDWHU VXSSO\RU x:LWKLQIHHWRIDSULYDWHZDWHUVXSSO\ZHOO  3RWHQWLDOGULQNLQJZDWHUVRXUFHDUHDVDUHGHILQHGDVDUHDV  xIHHWRUPRUHIURPDSXEOLFZDWHUVXSSO\OLQH x:LWKLQDQDUHDGHVLJQDWHGE\DPXQLFLSDOLW\VSHFLILFDOO\IRUWKHSURWHFWLRQRI JURXQGZDWHUTXDOLW\RU x:LWKLQD3RWHQWLDOO\3URGXFWLYH$TXLIHU 33$ WKDWKDVQRWEHHQH[FOXGHGDVD 1RQ3RWHQWLDO'ULQNLQJ:DWHU6RXUFH$UHD 13':6$   7KHHDVWHUQSRUWLRQRIORWLVZLWKLQDPDSSHGPHGLXP\LHOGDTXLIHUZKLFKLVD SRWHQWLDOGULQNLQJZDWHUVRXUFHDUHD3RUWLRQVRIWKH6LWHDUHORFDWHGPRUHWKDQIHHW IURPDSXEOLFZDWHUVXSSO\$GGLWLRQDOO\WKH1RUWKDPSWRQ+HDOWK'HSDUWPHQWLGHQWLILHG WZRSULYDWHZHOOVZLWKLQIHHWRIWKH6LWH%DVHGRQWKLVLQIRUPDWLRQWKHDSSOLFDEOH JURXQGZDWHUFODVVLILFDWLRQDWWKH6LWHZRXOGEH5&*:  6RLOORFDWHGZLWKLQIHHWRIUHVLGHQWLDOSURSHUW\RUVFKRRORUZLWKLQDFXUUHQWRU SRWHQWLDOGULQNLQJZDWHUVRXUFHDUHDLVFODVVLILHGDV5&6%DVHGRQWKHDERYH LQIRUPDWLRQ6LWHVRLOVDUHFODVVLILHGDV5&6,IDUHOHDVHRFFXUVRQWKH6LWHWKHVH UHSRUWLQJFODVVLILFDWLRQVVKRXOGEHUHYLHZHGE\DQ/63SULRUWRFRQGXFWLQJZRUNRQWKH 6LWH  5DGRQ=RQHV  (QYLURQPHQWDO3URWHFWLRQ$JHQF\ (3$ UDGRQ]RQHPDSVDYDLODEOHRQOLQHDWKWWS ZZZHSDJRYUDGRQVWDWHVPDVVDFKXVHWWVKWPOUHIOHFWWKHDYHUDJHVKRUWWHUPUDGRQ PHDVXUHPHQWWKDWFDQEHH[SHFWHGLQDEXLOGLQJZLWKRXWWKHLPSOHPHQWDWLRQRIUDGRQ FRQWUROPHWKRGV7KHUDGRQ]RQHGHVLJQDWLRQRIWKHKLJKHVWSULRULW\LV=RQHDQGWKH GHVLJQDWLRQIRUWKHORZHVWLV=RQH7KHPDSVLQGLFDWHWKDWWKH6LWHLVORFDWHGLQD=RQH  PRGHUDWHSRWHQWLDO DUHDLQGLFDWLQJDYHUDJHSRWHQWLDOUDGRQOHYHOVRIWZRWRIRXU S&L/ 6,7(5(&211$,66$1&( 0(7+2'2/2*<$1'/,0,7,1*&21',7,216  7KH6LWHUHFRQQDLVVDQFHZDVSHUIRUPHGE\0V6DEULQD0RUHDXRI272RQ-XO\ 3KRWRJUDSKVRIWKH6LWHWDNHQGXULQJWKH6LWHUHFRQQDLVVDQFHDUHDWWDFKHGLQ $SSHQGL[%$Q$6706LWH5HFRQQDLVVDQFH4XHVWLRQQDLUHZDVFRPSOHWHGE\272DQG LVDWWDFKHGLQ$SSHQGL[)5HOHYDQWLQIRUPDWLRQLVLQFOXGHGLQWKH6LWHUHFRQQDLVVDQFH VHFWLRQVEHORZ         3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  2XU6LWHYLVLWZDVSHUIRUPHGIROORZLQJWKHJXLGHOLQHVSUHVHQWHGLQ6HFWLRQRI$670 6WDQGDUG(7KHIROORZLQJREVHUYDWLRQVDUHSUHVHQWHGDVRXWOLQHGLQWKH$670 6WDQGDUG  6,7(6(77,1*$1'2%6(59$7,216  $VGLVFXVVHGLQ6HFWLRQWKH6LWHFRQVLVWVRIWZRORWVWRWDOLQJDSSUR[LPDWHO\DFUHV 7KH6LWHLVSULPDULO\XQGHYHORSHGZRRGHGODQGZLWKDVPDOOERDUGHGXSEXLOGLQJORFDWHG LQWKHQRUWKHUQSRUWLRQRIORW%DVHGRQ6LWHKLVWRU\WKLVEXLOGLQJZDVOLNHO\WKH IRUPHU6DQG\¶V6SHHG6KRS2YHUKHDGWUDQVPLVVLRQOLQHHDVHPHQWVDQGDQDWXUDOJDV HDVHPHQWZLWKSXPSKRXVHVWUDQVHFWWKH6LWH3DUWRIWKHQDWXUDOJDVHDVHPHQWLQFOXGHV WKHXQGHUJURXQGQDWXUDOJDVXWLOLW\DQGDJUDYHODFFHVVURDGH[WHQGLQJVRXWKIURP5RFN\ +LOO5RDGWRWZRIHQFHGEXLOGLQJV SXPSKRXVHV XVHGWRPDLQWDLQQDWXUDOJDVSUHVVXUH ZLWKLQWKHVXEVXUIDFHXWLOLW\3KRWRJUDSKVGRFXPHQWLQJWKHFRQGLWLRQVRIWKH6LWHDUH DWWDFKHGLQ$SSHQGL[%  +D]DUGRXV6XEVWDQFHVDQG3HWUROHXP3URGXFWV 7KHUHZHUHQRKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWVREVHUYHGDWWKH6LWHGXULQJ WKH6LWHUHFRQQDLVVDQFH  6WRUDJH7DQNV  7KHUHZDVQRHYLGHQFHRIFXUUHQWRUIRUPHUSHWUROHXPRUKD]DUGRXVPDWHULDOVWRUDJH WDQNVREVHUYHGDWWKH6LWHGXULQJWKH6LWHUHFRQQDLVVDQFH  2GRUV  1RXQXVXDORGRUVZHUHREVHUYHGDWWKH6LWHRULPPHGLDWHO\DEXWWLQJSURSHUW\GXULQJRXU 6LWHUHFRQQDLVVDQFH  3RROVRI/LTXLG  7KHUHZDVQRSRROLQJRUVWDQGLQJZDWHUREVHUYHGDWWKH6LWHGXULQJWKH6LWH UHFRQQDLVVDQFH  'UXPV  7KHUHZHUHQRGUXPVREVHUYHGDWWKH6LWHGXULQJWKH6LWHUHFRQQDLVVDQFH  +D]DUGRXV6XEVWDQFHVDQG3HWUROHXP3URGXFWV&RQWDLQHUV  7KHUHZHUHQRKD]DUGRXVVXEVWDQFHVRUSHWUROHXPSURGXFWVREVHUYHGGXULQJWKH6LWH UHFRQQDLVVDQFH  8QLGHQWLILHG6XEVWDQFH&RQWDLQHUV  1RXQLGHQWLILHGVXEVWDQFHFRQWDLQHUVZHUHREVHUYHGDWWKHWLPHRIWKHUHFRQQDLVVDQFH          3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  3&%V  3ROHPRXQWHGWUDQVIRUPHUVZHUHREVHUYHGDORQJWKHRYHUKHDGHOHFWULFXWLOLW\OLQH HDVHPHQW7KHDJHDQG3&%FRQWHQWRIWKHVHWUDQVIRUPHUVLVXQNQRZQ  ,QWHULRU2EVHUYDWLRQV  7KHUHLVRQHEXLOGLQJRQVLWHDQDSSUR[LPDWHO\WHQIRRWE\WHQIRRWVWUXFWXUHWKDW DSSHDUVWRKDYHEHHQRXWRIXVHIRUPDQ\\HDUV%RDUGVZHUHSUHVHQWRYHUWKHEXLOGLQJ GRRUDQGZLQGRZVDWWKHWLPHRIRXUUHFRQQDLVVDQFHVRZHFRXOGQRWDFFHVVWKH EXLOGLQJRUYLHZWKHLQWHULRU7KHEXLOGLQJKDVDFLQGHUEORFNFKLPQH\VXJJHVWLQJLWZDV KHDWHG1RDERYHJURXQGVWRUDJHWDQNVRUILOORUYHQWSLSHVZHUHREVHUYHGDURXQGWKH EXLOGLQJH[WHULRU  7KHSXPSKRXVHEXLOGLQJVDVVRFLDWHGZLWKWKHQDWXUDOJDVHDVHPHQWDUHQRWRQWKH6LWH SDUFHOV ([WHULRU2EVHUYDWLRQV3LWV3RQGVRU/DJRRQV  $VGHVFULEHGLQWKHUHLVQRVWDQGLQJZDWHUSLWVSRQGVRUODJRRQVREVHUYHGDWWKH 6LWHRULPPHGLDWHO\DEXWWLQJSURSHUW\GXULQJRXU6LWHUHFRQQDLVVDQFH  ([WHULRU2EVHUYDWLRQV6WDLQHG6RLORU3DYHPHQW  7KHUHZDVQRVWDLQHGVRLORUSDYHPHQWREVHUYHGDWWKH6LWHGXULQJWKH6LWH UHFRQQDLVVDQFH  ([WHULRU2EVHUYDWLRQV6WUHVVHG9HJHWDWLRQ  1RVWUHVVHGYHJHWDWLRQZDVREVHUYHGDWWKH6LWHRULPPHGLDWHO\DEXWWLQJSURSHUW\GXULQJ RXU6LWHUHFRQQDLVVDQFH  ([WHULRU2EVHUYDWLRQV6ROLG:DVWH  7KHERG\RIDQDSSUR[LPDWHO\V9&KHYUROHWZDVREVHUYHGQRUWKRIWKHDFFHVV URDGLQWKHQRUWKHUQSRUWLRQRIWKH6LWH7KHJODVVWLUHVDQGPHFKDQLFDOSDUWVXVXDOO\ FRQWDLQLQJIOXLGV VXFKDVWKHHQJLQHJDVWDQNRLOWDQNDQGUDGLDWRU ZHUHQRWSUHVHQW 1RRWKHUVLJQLILFDQWVROLGZDVWHZDVREVHUYHGDWWKH6LWHGXULQJWKH6LWH UHFRQQDLVVDQFH  ([WHULRU2EVHUYDWLRQV:DVWH:DWHU  :DVWHZDWHURURWKHUOLTXLG LQFOXGLQJVWRUPZDWHU ZDVQRWREVHUYHGGLVFKDUJLQJWR GLWFKHVGUDLQVRUVWUHDPVGXULQJRXU6LWHYLVLW ([WHULRU2EVHUYDWLRQV:HOOV  1RZHOOVZHUHREVHUYHGDWWKH6LWHGXULQJRXU6LWHYLVLW          3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  ([WHULRU2EVHUYDWLRQV6HSWLF6\VWHPV  1RLQGLFDWLRQRIVHSWLFV\VWHPVZDVREVHUYHGRQWKH6LWH7KH6LWHYLFLQLW\LVFRQQHFWHG WRWRZQZDWHUDQGVHZHU  ,17(59,(:6  ,17(59,(:6:,7+2:1(562&&83$1766,7(0$1$*(5  7KHRZQHU¶VDWWRUQH\IRUWKHVDOHRIWKHSURSHUW\$WWRUQH\%UDG6KLPHOFRQGXFWHGDQ LQWHUYLHZRYHUWKHSKRQHZLWKWKHRZQHU0UV&DURO+HZHVRQ-XO\XVLQJDQ $670LQWHUYLHZIRUPSURYLGHGE\2720UV+HZHVLQGLFDWHGVKHEHOLHYHGWKHUHWREH QRFXUUHQWRUIRUPHUHQYLURQPHQWDOSHUPLWVRUUHSRUWV$67V867VXVHRUVWRUDJHRI SHWUROHXPRUKD]DUGRXVSURGXFWVRUVSLOOVRUUHOHDVHVLQWKHYLFLQLW\RIWKH6LWH6KH LQGLFDWHGVKHZDVXQDZDUHLIWKHUHZHUHDQ\WUDQVIRUPHUVDVVRFLDWHGZLWKWKHRYHUKHDG HOHFWULFHDVHPHQW$FRS\RIWKHFRPSOHWHGLQWHUYLHZIRUPLVDWWDFKHGLQ$SSHQGL[*  ,17(59,(:6:,7+/2&$/*29(510(17$*(1&,(6  $UHSUHVHQWDWLYHRI272YLVLWHGWKH1RUWKDPSWRQ)LUH'HSDUWPHQWRQ-XO\ 272FRQWDFWHGWKH1RUWKDPSWRQ+HDOWK'HSDUWPHQWRQ-XO\,QIRUPDWLRQ FROOHFWHGGXULQJWKHLQWHUYLHZVKDVEHHQSUHVHQWHGLQSUHYLRXVVHFWLRQVRIWKLVUHSRUW  ),1',1*6  $3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQWIRUWKH6LWHORFDWHGEHWZHHQ5RFN\+LOO5RDG DQG(DVWKDPSWRQ5RDGDWORWVDQGLQ1RUWKDPSWRQ0DVVDFKXVHWWVKDV EHHQFRQGXFWHGE\2¶5HLOO\7DOERW 2NXQ$VVRFLDWHV,QF 272 7KLVUHSRUWKDVEHHQ SUHSDUHGLQJHQHUDODFFRUGDQFHZLWKWKH$6706WDQGDUG()RUWKHSXUSRVHVRI WKLVDVVHVVPHQWWKHWHUP³6LWH´KDVEHHQXVHGWRUHIHUWRWKHORWVDQG 7KHDVVHVVPHQWFRQVLVWHGRIDUHFRUGVUHYLHZD6LWHDQGDUHDUHFRQQDLVVDQFH LQWHUYLHZVZLWK6LWHUHSUHVHQWDWLYHVDUHYLHZRIUHJXODWRU\DJHQF\ILOHLQIRUPDWLRQ LQWHUYLHZVZLWKORFDOJRYHUQPHQWRIILFLDOVDQGSUHSDUDWLRQRIWKLVUHSRUW$VXPPDU\RI RXUILQGLQJVLVSUHVHQWHGEHORZ  'HVFULSWLRQDQG6HWWLQJ  7KH6LWHFRQWDLQVWZRLUUHJXODUO\VKDSHGXQGHYHORSHGSDUFHOVZKLFKWRWDO DSSUR[LPDWHO\DFUHV7KH6LWHLVORFDWHGLQDUXUDOUHVLGHQWLDODUHDRI5RFN\+LOO5RDG DQGDUXUDOFRPPHUFLDODUHDDORQJ(DVWKDPSWRQ5RDGRI1RUWKDPSWRQ0DVVDFKXVHWWV $EXLOGLQJDSSUR[LPDWHO\IHHWE\IHHWZLWKERDUGHGXSZLQGRZVDQGGRRUVLV ORFDWHGLQWKHQRUWKHUQSRUWLRQRIWKH6LWH$JUDYHOFRYHUHGDFFHVVURDGH[WHQGV VRXWKHDVWRI5RFN\+LOO5RDGWRDODQGORFNHG3DUFHORZQHGE\7HQQHFR*DV&RPSDQ\ 2QWKLVSDUFHOWKHUHLVDFKDLQOLQNIHQFHGDUHDFRQWDLQLQJWZREXLOGLQJVZKLFKDUHSXPS KRXVHVIRUPDLQWDLQLQJSUHVVXUHLQWKHVXEVXUIDFHQDWXUDOJDVOLQHWKDWWUDQVHFWVWKH QRUWKZHVWHUQSRUWLRQRIWKH6LWH7KHSXPSLQJVWDWLRQSDUFHOLVQRWSDUWRIWKHVXEMHFW 6LWH$QHDVHPHQWZLWKRYHUKHDGHOHFWULFWUDQVPLVVLRQOLQHVWUDQVHFWWKHQRUWKHUQ SRUWLRQVRIERWKSDUFHOV7KHSDUFHOVDUHGLYLGHGE\WKHQRUWKVRXWKRULHQWHG0DQKDQ 5DLO7UDLO7KHORWIURQWLQJ(DVWKDPSWRQ5RDG  KDVDQRUWKVRXWKRULHQWHG        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  RYHUKHDGWUDQVPLVVLRQOLQHVWKDWWUDQVHFWWKHORW7KHUHPDLQLQJSRUWLRQVRIERWKORWVDUH XQGHYHORSHGZRRGHGODQG  5HJXODWRU\)LOH,QIRUPDWLRQ  7KH(QYLURQPHQWDO'DWD5HVRXUFHVGDWDEDVHVHDUFKLGHQWLILHGUHOHDVHVZLWKLQWKH VHDUFKUDGLLIRUWKH6LWHEXWEDVHGRQGLVWDQFHIURPWKH6LWHUHJXODWRU\VWDWXVRIWKH UHOHDVHVDQGLQIHUUHGJURXQGZDWHUIORZGLUHFWLRQQRQHRIWKHVHDUHOLNHO\WRLPSDFW6LWH VRLODQGRUJURXQGZDWHUWRUHSRUWDEOHOHYHOV  5HFRUGVLQGLFDWHDFORVHGVROLGZDVWHODQGILOOLVORFDWHGLPPHGLDWHO\HDVWRIWKH6LWHDW (DVWKDPSWRQ5RDG7KHOLVWLQJVLQGLFDWHWKDWLWLVDQXQOLQHGODQGILOOWKDWZDVDFWLYH EHWZHHQDQGDQGWKDWLWZDVFORVHGLQ7KLVSURSHUW\LVWKHFXUUHQW ORFDWLRQRI9DOOH\5HF\FOLQJDQG7UDQVIHU6WDWLRQ7KHPDSSHGOLPLWVRIWKHODQGILOOGRQRW H[WHQGRQWRWKH6LWH%DVHGRQWKHORFDOWRSRJUDSK\WKH6LWHLVOLNHO\K\GUDXOLFDOO\ XSJUDGLHQWRIODQGILOO  +LVWRU\  7KH6LWHDFFHVVURDGSXPSLQJVWDWLRQDQGRYHUKHDGWUDQVPLVVLRQOLQHVZHUH FRQVWUXFWHGVRPHWLPHEHWZHHQDQG,QDIRRWE\IRRWEXLOGLQJ ZDVFRQVWUXFWHGDW5RFN\+LOO5RDG7KLVEXLOGLQJDSSHDUVWRKDYHEHHQRFFXSLHG E\6DQG\¶V$XWR6DOHVDQGRU6DQG\¶V6SHHG(TXLSPHQW DXWRSDUWV XQWLODWOHDVW 7KHUHLVQRLQGLFDWLRQRIDJDUDJHRURQVLWHVHUYLFLQJRIYHKLFOHVDWWKLVORFDWLRQ7KH SRUWLRQVRIWKH6LWHRWKHUWKDQHDVHPHQWVRU6DQG\¶V6SHHG(TXLSPHQWUHPDLQHG ZRRGHGDQGXQGHYHORSHGIURPWKURXJK  6WRUDJH7DQNV  7KHUHDUHQRUHFRUGVRUYLVXDOLQGLFDWLRQVRIFXUUHQWRUIRUPHUVWRUDJHWDQNVDWWKH6LWH  6LWH5HFRQQDLVVDQFH  7KH6LWH5HFRQQDLVVDQFHZDVSHUIRUPHGRQ-XO\2XU6LWHYLVLWZDVSHUIRUPHG IROORZLQJJXLGHOLQHVLGHQWLILHGLQ6HFWLRQRI$6706WDQGDUG(2QHERDUGHG XSEXLOGLQJDQGRQHYHKLFOHVKHOOZHUHREVHUYHGRQ6LWH:HREVHUYHGQRFRQGLWLRQV LQGLFDWLQJDUHSRUWDEOHUHOHDVHRUWKUHDWRIUHOHDVHFRQGLWLRQDWWKH6LWH  23,1,21$1'&21&/86,216  :HKDYHSHUIRUPHGD3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQWLQFRQIRUPDQFHZLWKWKH VFRSHDQGOLPLWDWLRQVRI$6703UDFWLFH(IRUWKH&LW\RI1RUWKDPSWRQDWWZRORWV DQGLQ1RUWKDPSWRQ0DVVDFKXVHWWV7KLVDVVHVVPHQWKDVUHYHDOHGQR HYLGHQFHRID5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ 5(& +LVWRULFDO5HFRJQL]HG (QYLURQPHQWDO&RQGLWLRQ +5(& RU&RQWUROOHG5HFRJQL]HG(QYLURQPHQWDO&RQGLWLRQ &5(& LQFRQQHFWLRQZLWKWKHSURSHUW\WKDWZRXOGUHTXLUHIXUWKHUDFWLRQ  $VZLWKPDQ\SURSHUWLHVVXFKDVWKH6LWHWKHSRVVLEOHSUHVHQFHRIXQGLVFRYHUHG UHOHDVHVRIRLOVRUKD]DUGRXVPDWHULDOVLVDSRVVLELOLW\ZKLFKFDQQRWEHUXOHGRXW FRPSOHWHO\ZLWKRXWVXEVXUIDFHH[SORUDWLRQVDQGFKHPLFDOWHVWLQJRIVRLOVDQG        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  JURXQGZDWHU$VUHIHUUHGWRLQWKH$670VWDQGDUGQR(6$FDQZKROO\HOLPLQDWH XQFHUWDLQW\UHJDUGLQJHQYLURQPHQWDOPDWWHUVLQFRQQHFWLRQZLWKDVLWH  '(9,$7,216  :HDUHQRWDZDUHRIVLJQLILFDQWGHOHWLRQVRUGHYLDWLRQVIURPWKH$670( SUDFWLFHXVHGWRSUHSDUHWKLVUHSRUW  $'',7,21$/6(59,&(6  1RDGGLWLRQDOVHUYLFHVRXWVLGHRIWKH$670(SUDFWLFHKDYHEHHQSHUIRUPHGLQ FRPSOHWLQJWKLV3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW  5()(5(1&(6  x0V&DURO+HZHVRZQHURIWKH6LWH,QWHUYLHZZDVFRQWDFWHGRQ-XO\E\KHU VHOOLQJDWWRUQH\0U%UDG6KLPHOZKRFRPSOHWHGWKH,QWHUYLHZ)RUP x0U:D\QH)HLGHQ'LUHFWRURI3ODQQLQJDQG6XVWDLQDELOLW\7KH&LW\RI1RUWKDPSWRQ 8VHURIWKHUHSRUWFRPSOHWHGWKHXVHUTXHVWLRQQDLUHRQ-XO\ 8QLWHG6WDWHV*HRORJLFDO6XUYH\ 86*6 WRSRJUDSKLFPDS(DVWKDPSWRQ 0DVVDFKXVHWWV4XDGUDQJOH 1RUWKDPSWRQ$VVHVVRUV2IILFHFDUGVDQGPDSVIRUPDSORWQXPEHUDQG DYDLODEOHRQOLQHDWKWWSZZZQRUWKDPSWRQDVVHVVRUXVGRZQORDGHGRQ-XO\  1RUWKDPSWRQ%RDUGRI+HDOWK+HDWKHU0F%ULGHYLVLWHGRIILFHRQ 1RUWKDPSWRQ)LUH'HSDUWPHQW$VVLVWDQW&KLHI'XDQH1LFKROVYLVLWHGRQ +LVWRULF6DQERUQ)LUH,QVXUDQFH0DSV(QYLURQPHQWDO'DWD5HVRXUFHV ('5 5RFN\ +LOO5RDGDQG(DVWKDPSWRQ5RDG1RUWKDPSWRQ0DVVDFKXVHWWVUHSRUWGDWHG  +LVWRULF7RSRJUDSKLF0DSV(QYLURQPHQWDO'DWD5HVRXUFHV ('5 5RFN\+LOO5RDG DQG(DVWKDPSWRQ5RDG1RUWKDPSWRQ0DVVDFKXVHWWVUHSRUWGDWHG +LVWRULF$HULDO3KRWRJUDSKV(QYLURQPHQWDO'DWD5HVRXUFHV ('5 5RFN\+LOO5RDG DQG(DVWKDPSWRQ5RDG1RUWKDPSWRQ0DVVDFKXVHWWVUHSRUWGDWHG +LVWRULF6WUHHW'LUHFWRULHV(QYLURQPHQWDO'DWD5HVRXUFHV ('5 5RFN\+LOO5RDG DQG(DVWKDPSWRQ5RDG1RUWKDPSWRQ0DVVDFKXVHWWVUHSRUWGDWHG (QYLURQPHQWDO'DWD5HVRXUFHV ('5 5DGLXV5HSRUW5RFN\+LOO5RDGDQG (DVWKDPSWRQ5RDG1RUWKDPSWRQ0DVVDFKXVHWWVUHSRUWGDWHG 0DVV'(3ZDVWH6LWHDQG5HSRUWDEOH5HOHDVHVORRNXSRQOLQHDWKWWSGEVWDWHPD XVGHSFOHDQXSVLWHVVHDUFKDVSORFDWHGRQ 0DVV*,63ULRULW\5HVRXUFH ( 0DS5RFN\+LOO5RDG1RUWKDPSWRQ 0DVVDFKXVHWWVDYDLODEOHRQOLQHDW KWWSPDSVPDVVJLVVWDWHPDXVLPDJHVGHSPFSPFSKWPORFDWHGRQ (QYLURQPHQWDO3URWHFWLRQ$JHQF\ (3$ UDGRQ]RQHPDSVDYDLODEOHRQOLQHDWKWWS ZZZHSDJRYUDGRQVWDWHVPDVVDFKXVHWWVKWPOUHYLHZHG  (19,5210(17$/352)(66,21$/67$7(0(17  9DOHULH7LOOLQJKDVWGHFODUHVWKDWWRWKHEHVWRIKHUSURIHVVLRQDONQRZOHGJHDQGEHOLHI VKHPHHWVWKHGHILQLWLRQRI(QYLURQPHQWDO3URIHVVLRQDODVGHILQHGLQ3DUWRI&)5        3DJH  [ASSOCIATES]      $XJXVW 3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQW /RWVDQG 1RUWKDPSWRQ0$  6KHKDVWKHVSHFLILFTXDOLILFDWLRQVEDVHGRQHGXFDWLRQWUDLQLQJDQGH[SHULHQFHWR DVVHVVDSURSHUW\RIWKHQDWXUHKLVWRU\DQGVHWWLQJRIWKHVXEMHFWSURSHUW\:HKDYH GHYHORSHGDQGSHUIRUPHGWKHDSSURSULDWHLQTXLULHVLQFRQIRUPDQFHZLWKWKHVWDQGDUGV DQGSUDFWLFHVVHWIRUWKLQ&)53DUW  48$/,),&$7,2162)(19,5210(17$/352)(66,21$/6  9DOHULH7LOOLQJKDVWDQ$VVRFLDWHDW272DQGD/LFHQVHG6LWH3URIHVVLRQDO /63 KDV RYHU\HDUVRIH[SHULHQFHLQHQYLURQPHQWDOVLWHDVVHVVPHQWDQGUHPHGLDWLRQ6KH KROGVDQXQGHUJUDGXDWHGHJUHHLQFKHPLVWU\DQGELRORJ\DQGDPDVWHU¶VGHJUHHLQ DQDO\WLFDOFKHPLVWU\0V7LOOLQJKDVWKDVDVWURQJWHFKQLFDODQGFKHPLVWU\EDFNJURXQG DQGVSHFLDOL]HVLQZDVWHVLWHFKDUDFWHUL]DWLRQDQGUHSRUWLQJLQDFFRUGDQFHZLWKWKH 0DVVDFKXVHWWV&RQWLQJHQF\3ODQ 0&3   6DEULQD0RUHDXLVDQHQYLURQPHQWDOVFLHQWLVWZKRKDVVL[\HDUVRIH[SHULHQFHLQWKH FRQVXOWLQJILHOG6LQFHMRLQLQJ2720V0RUHDXKDVIRFXVHGRQFRQGXFWLQJILHOGZRUN HQYLURQPHQWDOVLWHDVVHVVPHQWVDQGUHPHGLDWLRQDFWLYLWLHVWKURXJKRXW0DVVDFKXVHWWV 6KHHDUQHGD%DFKHORU¶VRI6FLHQFH'HJUHHLQ(QYLURQPHQWDO6FLHQFHIURP8QLYHUVLW\RI 1HZ+DPSVKLUHLQ                   7$%/(6  7DEOH 6WDQGDUG(QYLURQPHQWDO5HFRUGV6RXUFHV  /LVWV$SSURSULDWH0LQLPXP 6HDUFK5DGLXV PLOHV  )HGHUDO13/VLWHOLVW )HGHUDO'HOLVWHG13/VLWHOLVW )HGHUDO&(5&/,6OLVW )HGHUDO&(5&/,61)5$3VLWHOLVW )HGHUDO5&5$&255$&76IDFLOLWLHVOLVW )HGHUDO5&5$QRQ&255$&7676'IDFLOLWLHVOLVW )HGHUDO5&5$JHQHUDWRUVOLVW )HGHUDO,QVW(QJ&RQWUROV )HGHUDO(516OLVW7DUJHW3URSHUW\ 6WDWHDQG7ULEDOKD]DUGRXVZDVWHVLWHV 6WDWHDQG7ULEDOODQGILOOVRUVROLGZDVWHGLVSRVDOVLWHV 6WDWHDQG7ULEDO/867/$67 6WDWHDQG7ULEDOUHJLVWHUHGVWRUDJHWDQNOLVW 6WDWHDQG7ULEDOLQVWLWXWLRQDOFRQWUROV 6WDWHDQG7ULEDOYROXQWDU\FOHDQXSVLWHV 6WDWHDQG7ULEDO%URZQILHOGVLWHV   1RWHV 6HDUFKUDGLLPHHWRUH[FHHGWKHUDGLLUHTXLUHGE\$6706WDQGDUG(                  ),*85(6  6RXUFH0DVV*,67RSRJUDSKLF0DSVKWWSPDSVPDVVJLVVWDWHPDXVPDSBROROLYHUSKSUHYLHZHGRQ O'REILLY, TALBOT & OKUN ASSOCIATES, INC. 'DWH-XO\),*85(12 6,7(/2&86 -RE1R /276$1' 1257+$03721 Scale 1" = 300' 0$66$&+86(776 N 6,7( Source: Google Earth Imagery dated 5/10/14, Image reviewed on 7/18/14. O'Reilly Talbot & Okun Associates, Inc.J0285-22-01128 RockyHill Road (Lot 37-049) and Easthampton Road Lot ( Lot 37-062)Northampton, MassachusettsSite Sketch Not toScale Date: July 2014 Figure No.: 2 12 8 R o c k y H i l l R o a d Lo t 3 7 - 0 4 9 43 . 9 a c r e s Lo t 37 - 0 6 2 3. 7 a c r e s Ap p r o x i m a t e lo c a t i o n of Ea s e m e n t Bo u n d a r i e s Ap p r o x i m a t e l o c a t i o n of  Au t o m o b i l e Bo d y Ap p r o x i m a t e l o c a t i o n of  Bu i l d i n g                  $33(1',;$ 86(548(67,211$,5( Page 1 of 2 ASTM E1527-13 User Questionnaire Site Name and Address: Owner: Occupant: Form Completed By: Date: Representing: __________________________________________________________ In order to qualify for one of the landowner liability protections (LLPs) offered by the Small Business Liability Relief and Brownfield Revitalization Act of 2001 (the “Brownfields Amendments”) the user must provide the following information (if available) to the environmental professional. Failure to provide this information could result in a determination that “all appropriate inquiry” is not complete. (1.) Are you aware of any environmental cleanup liens against the property that are filed or recorded under federal, tribal, state or local law? (2.) Are you aware of any Activity and Use Limitations (AULs), such as engineering controls, land use restrictions or institutional controls that are in place at the Site and/or have been filed or recorded in a registry under federal, tribal, state or local laws? (3.) As the user of this ESA do you have specialized knowledge or experience related to the property or nearby properties? For example, are you involved in the same line of business as the current or former occupants of the property or an adjoining property so that you would have specialized knowledge of the chemicals and processes used by this type of business? 3PDLZ)JMM3PBEBOE&BTUIBNQUPO3PBE $BSPM)FXFT /POF FYDFQUGPSVUJMJUJFTBOEVUJMUZSJHIUTPGXBZ 8BZOF'FJEFO+VMZ  $JUZPG/PSUIBNQUPO DPOUSBDUQVSDIBTFS /P /P /P Page 2 of 2 (4.) Does the purchase price being paid for this property reasonably reflect the fair market value of the property? If you conclude that there is a difference, have you considered whether the lower purchase price is because contamination is known or believed to be present at the property? (5.) Are you aware of commonly known or reasonably ascertainable information about the property that would help the environmental professional to identify conditions indicative of releases or threatened releases? For example, as user: x Do you know of past uses of the property? x Do you know of specific chemicals that are or once were present at the property? x Do you know of spills or other chemical releases that have taken place at the property? x Do you know of any environmental cleanups that have taken place at the property? (6.)As the user of this ESA, based on your knowledge and experience related to the property are there any obvious indicators that point to the presence or likely presence of contamination at the property? :FT XFCFMJFWFUIBUUIJTSFGMFDUTUIFUSVFWBMVFPGUIFQSPQFSUZXJUIOPEJTDPVOUT 5IFQSPQFSUZDPOUBJOTBHBTQJQFMJOFJOBHFOFSBMMZFBTUXFTUBYJT BQPXFSMJOFJOB HFOFSBMMZOPSUITPVUIBDDFTT BOEBQSJWBUFJOIPMEJOHJOUIFNJEEMFPGUIF QSPQFSUZVTFEGPSQSFTTVSJOHBOBUVSBMHBTQJQFMJOF/PLOPXMFEHFPGSFMFBTFT /P PUIFSUIBOUIFOBUVSBMHBTBOEUIFPEPSBEEFEUPOBUVSBMHBT /P /P /P                   $33(1',;% 6,7(3+272*5$3+6 Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 1 Photograph 1: Lot 37-062 view to the north. Photograph 2: Lot 37-062 view to the northeast. Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 2 Photograph 3: Lot 37-062 view to the east. Photograph 4: Eastern portion of Lot 37-049 view to the northwest. Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 3 Photograph 5: Southern portion of Lot 37-049 view to the north.   Photograph 6: Access road in northwestern portion of lot 37-049, view to the southeast.   Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 4  Photograph7:Observed1940sautomobilelocatedtothenorthofthe accessroad.    Photograph8:PortionoftransmissionlineincentralportionofLot37Ͳ049, Viewtothesoutheast.  Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 5  Photograph9:PortionoftransmissionlineincentralportionofLot37Ͳ049, Viewtothenorthwest.    Photograph10:FencedbuildingownedbyTennecolocatedcentrallyonSite. Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 6  Photograph11:NorthernfencedbuildinglocatedcentrallyonSite occupiedbyBerkshiregas.    Photograph12:Subsurfacenaturalgaspipelineeasement, viewtothesouthwest.  Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 7  Photograph13:Markerforsubsurfacenaturalgaspipeline, viewtothenortheast.   Photograph14:NorthernsideofthebuildinglocatedonSite.  Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 8  Photograph15:WesternsideofthebuildinglocatedonSite.   Photograph16:EasternsideofthebuildinglocatedonSite.  Site Photographs ____________________________________________________________________________ J0285-22-01 Lots 37-049 and 37-062 July 21, 2014 Northampton, Massachusetts Page | 9  Photograph17:SouthernsideofthebuildinglocatedonSite.                    $33(1',;& +,6725,&$/'2&80(176 No r t h a m p t o n 7/31/2014 co m p _ n u m b e r w e l l l o c a t i o n p r o p e r t y o w n e r w e l l s ub n a m e PA R C E L _ I D (M M M - BB B - L L L ) 27 7 5 2 0 1 C o l e s M e a d o w R o a d G e o r g e P a g e 27 7 5 2 1 G e o r g e P a g e 27 7 5 8 0 J e f f H o p w o o d 80 8 5 8 2 C o l e s M e a d o w R o a d C o n t e m p o r a r y C o u n t r y 01 3 - 0 9 7 - 0 0 1 80 8 6 7 4 C o l e s M e a d o w R o a d C o n t e m p o r a r y C o u n t r y 01 3 - 0 0 1 - 0 0 1 11 0 0 6 L o t 4 C o l e s M e a d o w R o a d B e r c u m e B u i l d e r s 10 3 7 5 2 5 9 5 C o l e s M e a d o w R o a d B e r c u m e B u i l d e r s 03 - 0 2 7 - 0 0 1 11 8 3 4 5 5 7 9 C o l e s M e a d o w R o a d B e r c u m e B u i l d e r s 03 - 0 2 5 - 0 0 1 14 3 0 9 8 5 5 5 C o l e s M e a d o w R o a d J i m L a w r e n c e 03 - 0 3 3 - 0 0 1 80 8 4 7 8 C o l e s M e d o w R o a d P a u l + F a y e S i e n k a w i c a 01 3 - 0 9 8 - 0 0 1 14 8 3 5 9 6 7 C o n z S t r e e t M a s s - W e s t C o n s t r u c t i o n 30 9 9 1 4 1 1 8 C o n z S t re e t E n v i r o n m e n t a l C o m p l i a n c e 39 A - 0 2 0 - 0 0 1 25 3 8 1 8 C h r i s t o p h e r L . F r a n k 39 A - 0 0 1 - 0 0 1 27 7 6 4 7 1 2 C r a f t s A v e n u e D i c k e n C r a n e 31 D - 1 5 6 - 0 0 1 27 7 5 4 7 4 8 D a m o n R o a d C a r r y m a n , I n c . 18 D - 0 3 5 - 0 0 1 27 7 5 1 8 S a m K r i s c o n i 12 6 0 5 9 6 6 D r u r y L a n e B a r b a r a W i n k l e r 10 6 1 6 6 1 2 E a s t C e n t r e S t re e t G e o r g e M e r r i a m 11 A - 0 1 9 - 0 0 1 10 4 4 4 5 5 4 E a s t H a m m p t o n R o a d P r i d e I n c . 38 C - 0 7 5 - 0 0 1 14 1 8 5 7 5 4 E a s t h a m p t o n R o a d P r i d e I n c . 38 C - 0 7 5 - 0 0 1 15 4 3 9 3 2 3 4 E a s t h a m p t o n R o a d E d w a r d A l l e n 27 7 4 2 8 5 4 E a s t h a m p t o n R o a d P r i d e S e r v i c e S t a t i o n s C i t g o S t a t i o n 38 C - 0 7 5 - 0 0 1 27 7 4 9 2 3 7 6 E a s t h a m p t o n R o a d W a y s i d e A u t o & T r u c k S a l e s 04 4 - 0 5 6 - 0 0 1 27 7 6 0 2 5 E a s t h a m p t o n R o a d B e n o i t L a m o n t a g n e 27 7 6 0 9 G l e n n B u i l d i n g A s s o c i a t e s , I n c . 13 7 1 0 0 9 E a s y S t re e t F l o r e n c e L e B l a n c 12 4 5 2 0 3 8 0 E l m S t re e t N o r t h H a m p t o n H i g h S c h o o l N o r t h H a m p t o n H i g h S c h o o l 24 C - 0 4 2 - 0 0 1 13 3 5 1 2 E l m S t re e t & M i l t o n S t r e e t N o r t h a m p t o n S c h o o l D i s t r i c t N o r t h a m p t o n H i g h S c h o o l 31 D - 1 6 7 - 0 0 1 15 1 2 1 0 1 8 0 F a i r S t re e t E x t . A n g e l a & J o n P l a s s m a n n 03 2 - 0 0 8 - 0 0 1 27 7 4 1 7 K e n F u l c h e r & L i s a M e l e n d y W - 3 6 - 9 8 15 8 8 2 7 1 2 1 F l o r e n c e R o a d M a r l i n e M o r r i n 22 0 - 0 6 7 - 0 0 1 27 7 4 6 7 E a s t e r n T r e e & L a n d s c a p e C o n s t r u c t i o n C o r p o r a t i o n L a n d f i l l 27 7 4 7 0 E a s t e r n T r e e & L a n d s c a p e C o n s t r u c t i o n C o r p o r a t i o n L a n d f i l l 27 7 5 5 1 1 7 0 G l e n d a l e R o a d W E S C o n s t r u c t i o n C o r p o r a t i o n N o r t h a m p t o n S a n i t a r y L a n d f i l l 04 2 - 0 8 9 - 0 0 1 15 2 3 3 1 2 3 8 G l e n d a l e R o a d C i t y o f N o r t h a m p t o n 04 9 - 0 0 3 - 0 0 1 15 2 3 5 6 1 7 0 G l e n d a l e R o a d C i t y o f N o r t h a m p t o n L a n d F i l l 04 2 - 0 8 9 - 0 0 1 11 2 2 5 1 5 5 G r a n t A v e n u e T w i n C l e a n e r s 25 C - 0 9 9 - 0 0 1 14 1 8 5 6 5 1 - 6 3 G r a n t A v e n u e R o b e r t R a y m o n d 25 C - 0 9 8 - 0 0 1 27 7 4 4 5 4 1 G re e n l e a f D r i v e P i t c h k o B u i l d e r s , I n c . 04 3 - 1 2 7 - 0 0 1 10 2 6 1 4 2 0 H a m p d e n A v e n u e H a m p t o n C o u r t A p a r t m e n t s 25 0 3 2 1 2 0 H a m p t o n A v e n u e W o o d a r d & C u r r a n 32 C - 0 3 6 - 0 0 1 25 0 3 2 2 2 0 H a m p t o n A v e n u e W o o d a r d & C u r r a n 32 C - 0 3 6 - 0 0 1 15 7 7 6 0 2 0 H a m p t o n A v e n u e W o o d a r d & C u r r a n 32 C - 0 3 6 - 0 0 1 11 0 0 7 8 7 3 - 8 7 7 H a r r i s o n A v e W a d e i g h E n v i r o n m e n t a l 27 7 5 2 2 4 0 H a t f i e l d S t re e t K u r z A s s o c i a t e s , I n c . 17 D - 0 3 2 - 0 0 1 27 7 5 0 2 1 5 H a w l e y S t re e t S h a w m u t B a n k B r o o k s i d e S q u a r e C o n d o 32 A - 1 5 8 - 0 0 4 15 3 7 1 2 3 1 0 H a y d e n v i l l e R o a d P a t r i c k J . M e l n i k S r . 13 1 4 5 3 5 7 4 H a y d e n v i l l e R o a d 06 - 0 0 4 - 0 0 1 27 7 4 3 6 2 0 0 I n d u s t r i a l D r i v e T e m p - P r o , I n c . 18 D - 0 6 4 - 0 0 1 27 7 4 4 4 2 0 0 I n d u s t r i a l D r i v e T e m p - P r o , I n c . 18 D - 0 6 4 - 0 0 1 27 7 4 5 0 1 7 5 I n d u s t r i a l D r i v e A l m e r H u n t l e y , J r . & A ss o c i a t e s , I n c . N o r t o n I n d u s t r i a l C e r a m i c s 18 D - 0 5 8 - 0 0 1 27 7 5 2 6 H e r i t a g e B a n k & T r u s t C o m p a n y H a r l o w & T i c k , I n c . 25 3 8 1 9 T o d d R . F a p p i a n o No r t h a m p t o n 7/31/2014 co m p _ n u m b e r w e l l l o c a t i o n p r o p e r t y o w n e r w e l l s ub n a m e PA R C E L _ I D (M M M - BB B - L L L ) 27 8 9 9 0 4 9 R i d g e V i e w R d S a u l K u h r 04 1 - 0 5 9 - 0 0 1 14 5 6 7 0 7 1 R i d g e v i e w R o a d S o v e r e i g n B u i l d e r s , I n c 04 8 - 0 2 6 - 0 0 1 14 1 2 1 4 3 8 R i d g e v i e w R o a d S o v e r e i g n B u i l d e r s I n c . 04 1 - 0 6 2 - 0 0 1 14 3 6 8 9 1 0 0 R i v e r R o a d B e r k s h i r e C a b l e C o r p . 05 - 0 3 2 - 0 0 1 14 3 6 8 8 1 0 0 R i v e r R o a d B e r k s h i r e C a b l e C o r p . 05 - 0 3 2 - 0 0 1 27 7 6 0 3 2 7 R i v e r R o a d B e r k s h i r e E l e c t r i c C a b l e C o . 05 - 0 3 2 - 0 0 1 27 7 6 4 0 A u d u b o n P a r t n e r s , L L P - G a r s o n F i e l d s 80 8 0 4 8 R i v e r R o a d R o b e r t G r o u t 10 B - 0 1 7 - 0 0 1 27 7 6 3 1 G a r y H a r t w e l l W - 1 4 8 - 8 5 , G r i d L o c a t i o n C - 6 27 7 4 1 0 27 7 4 9 1 4 0 R o e A v e n u e J o h n L e n n o n 24 A - 1 3 8 - 0 0 1 27 7 5 4 6 C a r r y m a n , I n c . 13 5 5 1 4 4 7 4 R o u t e 1 0 , E a s t S o u t h a m p t o n R o a d G a r y W i l s o n 25 3 8 2 0 M A H i g h w a y G a r a g e M A H i g h w a y G a r a g e 27 7 5 1 1 M a s s a c h u s e t t s S t a t e P o l i c e M a s s a c h u s e t t s S t a t e P o l i c e B a r r a c k s 17 8 7 5 R o u t e 5 M a s s a c h u s e t t s H i g h w a y 17 8 7 6 R o u t e 5 M o u n t T o m R o a d H i g h w a y D e p a r t m e n t 17 2 5 2 R o u t e 5 , M o u n t T o m R o a d H i g h w a y D e p a r t m e n t F a c i l i t y # 2 0 27 7 5 4 0 J i m B o y l e , S r . 27 7 5 0 6 D a v i d S t e v e n s 27 7 6 0 5 W i l l i a m M a z o c h 27 7 5 8 6 D a v i d W e i s e 27 7 6 5 4 W z o r e k R e d i m i x C e m e n t P l a n t 27 7 6 5 5 J a m e s W z o r e k , J r . 27 7 5 8 3 J C h a k a l o s I n v e s t m e n t s , I n c . 27 7 5 6 8 J C h a k a l o s I n v e s t m e n t s , I n c . 10 9 4 4 8 3 8 R u s s e l l w o o d R i d g e T e o n B u i l d e r s 01 1 - 0 2 1 - 0 0 1 13 0 6 0 8 5 0 R u s t l e w o o d R i d g e K e n t P e c o y & S o n s 01 2 - 0 3 2 - 0 0 1 27 7 5 5 6 L a t h r o p R e t i r e m e n t C o m m u n i t i e s W e l l # 3 27 7 5 5 7 L a t h r o p R e t i r e m e n t C o m m u n i t i e s W e l l # 1 27 7 5 5 8 L a t h r o p R e t i r e m e n t C o m m u n i t i e s W e l l # 2 27 7 6 1 6 E d w a r d J a z a d 27 7 5 8 7 5 S h e p h e r d s H o l l o w R o a d A u t u m n C o r p o r a t i o n - V i n c e B u r g e r 27 7 5 9 2 6 S h e p h e r d s H o l l o w R o a d A u t u m n C o r p o r a t i o n - V i n c e B u r g e r 27 7 5 9 6 8 S h e p h e r d s H o l l o w R o a d S y l v i a Z a k r z e w s k i 27 7 5 9 9 3 S h e p h e r d s H o l l o w R o a d P a u l J u d d 27 7 5 4 8 D . S . R e i n h a r d t 14 8 1 9 5 3 7 7 S i l v e s t e r R o a d T i m & M e l i s s a S e y m o u r 02 8 - 0 7 9 - 0 0 1 12 0 6 3 5 L o t 1 4 S i l v e s t e r R o a d D a v e M c c u t c h e o n 12 6 0 8 9 2 9 6 S i l v e s t o r R o a d A d a m L e s t e o 02 8 - 0 6 1 - 0 0 1 27 7 4 5 8 3 2 - 3 6 S m i t h S t re e t R a l p h ' s W e l d i n g & F a b r i c a t i o n 32 C - 1 0 7 - 0 0 1 27 7 6 5 6 P r o B r u s h D i v i s i o n V i s t r o n C o r p o r a t i o n 10 0 4 8 7 L o t 0 0 2 S p r i n g S t r e e t A n d y C h u r c h 22 B - 0 0 2 - 0 0 1 27 7 5 3 5 6 5 S t a t e S t re e t E d w a r d C a v a l l a r i S e r i o ' s M a r k e t 31 B - 2 6 5 - 0 0 1 10 9 4 2 L o t 1 S t o n e R u n J e f f H o o d / E l i z a b e t h H o u d e 11 6 1 3 9 S t r o n g S t re e t E r i c S u h e r 15 7 5 6 3 1 9 8 S y l v e s t e r R o a d A r m a n d L a P a l m e 02 3 - 0 1 5 - 0 0 1 27 7 4 1 1 5 4 5 S y l v e s t e r R o a d T i m Z a w a l i c k 02 1 - 0 0 6 - 0 0 1 27 7 5 1 0 2 S y l v e s t e r R o a d D o u g K o h l 27 7 5 1 3 J o A n n B e s s e t t e 4 8 0 - 1 3 0 - 9 2 27 7 5 2 3 J . L . S l a t t e r y , I n c . 27 7 6 1 2 M a r t i n Z a t a r i a n 27 7 6 3 9 B e r n a r d B l a k e s l e y MT TOMRD-RT 5 FERRY RD FRANKLIN ST INDUSTRIAL DR CENTER ST GREEN ST WARFIELDPL NORTH MAIN ST-RT 9 MAIN ST-RT9 BARRETT PL WATER ST ELM ST-RT 9 CRABAPPLE LN WHITTIER ST LEONARD ST MARIAN ST NORTHAMPTONST (LAUREL P BARDW ELL ST LOOKPARKACCESS STRAW AVE HOLYOKE ST MEADOW ST SOUTH ST-RT 10 CONZ ST LOCUST ST-RT 9 BELANGER PL ASPEN LN WHITTIER ST BAKER HILL RD LOOK PARK ACCESS UNION ST HAWLEY STBRIDGE ST FULTON AVE CRAFTS AVE NORTH ELM ST LOOK PARK ACCESS GREEN ST RUSTLEWOOD RIDGE HANCOCK ST HAMPDEN ST CRABAPPLE LN NORTH ELM ST-RT 9 HATFIELD ST BLISS ST PLEASANTST-RT 5 GARFIELD AVE BANKAVE SHALLOWBROOK DR BRIERWOOD DR HOCKANUM RD KING ST & RTE 5 NEW SOUTHST -MAIN ST CENTER CT WRIGHT AVE OLD SOUTH ST I-91 I-91 BANCROFT RD SCOTT AVE (LAUREL PARK) ROUND HILL RD DOGWOOD LN BERENSON PL NORTH ST I-91 ARLINGTON ST WARD AVE STILSON AVE PARKAVE DIAMOND CT ALAMO CT FAIRWAYVILLAGEACCESS FAIRWAY VILLAGE ACCESS THE CIRCLE (LAUREL PARK) BARRETT ST I-91 WASHINGTON PL TRUMBULL RD MAIN ST - NEWSOUTH ST PROSPECT ST CRACKERBARREL ALLEY I-91 RYAN RD ROCKLAND HGTS CLOVERDALE ST FRONT ST BRIGHT AVE COLLEGE LN DRYADS GREEN MULBERRY ST GREENLEAF DR SYLVAN LN DRYADS GREEN I-91 GROVE AVE IRWINPL OLD FERRY RD I-91 SPRINGFIELDST (LAUREL P EARLEST DOGWOOD LN I-91 VIEWAVE LOOK PARK ACCESS STEARNS CT RESERVOIR RD PARSONS ST SERVICE CTR RD MASONIC ST WALNUT ST ELM ST CONNECTOR FRANKLIN CT LOOK PARK ACCESS MARCCIR SCHOOL ST EAST ST I-91 NORTH KING ST-RT 5 & 10 SHEPARDS FARMS RD SHORTST PARADISE RD KARYST BURNCOLT RD MEADOW ST BERNACHE ST CROSBY ST MERRICK LN MILLBANK PL FAIRWAY VILLAGE ACCESS MASSASOIT AVE FAIRWAY VILLAGE ACCESS FAIRWAY VILLAGE ACCESS BAKER HILL RD FLORIDAAVE PINE VALLEY RD EMBURY LN (LAUREL PARK) EASTERN AVE STATE ST HINCKLEY ST FAIRWAY VILLAGE ACCESS LAWNAVE SMITH ST BEDFORD TERR GLEASON RD RANDOLPH PL MARSHALL ST MAPLE ST FOURTHAVE I-91 PINE ST HAMPTON TERR ASHBURY AVE (LAUREL PARK DENNISTON PL WOODMONT RD KIMBALL ST FLORENCE ST CRESCENT ST BRADFORD ST CALVIN TERR CARPENTER AVE DEERFIELD DR CAHILLANE TERR BEECH ST JUNIPERST OAK ST WILLIAMS ST ACREBROOK DR I-91 SPRUCE HILL AVE CLARK AVE (LAURELPARK) MILLYARDRD ARNOLDAVE GREELEYAVE SOUTHPARKTERR BROOKWOOD DR BAKER ST (LAURELPARK) SANDERSON AVE BUTTERNUT LN SUNHILL DR FINN ST NORTH MAPLE ST REDFORD DR NORWOOD AVE ALLEN RD I-91 WILLOW ST MONTVIEW AVE I-91 WESTERNAVE PROSPECTCT WHITTIERST WATER ST BOTTOMSRD FAIRWAY VILLAGE ACCESS LADD AVE BRATTONCT HAWTHORNE LN MADISONAVE ALLEN RD FOREST GLEN DR BUTTON ST CAROLYN ST TRINITYCIR (LAUREL PARK HAYWARDRD TRUMBULLRD BROOKSIDE CIR LILLY ST BLACKBERRY LN MARKET ST LAURELPARK FRANCIS ST KING AVE GROVE HILL INDIANHILL POMEROY TERR TRINITYROW HAWTHORNE TERR FIRETHORNLN BEACO N ST HUBBARD AVE PINES EDGE DR LOOKPARKACCESS WOOD AVE BREWSTER CT JACKSON ST NONOTUCK ST HIGH ST SWAN ST FEDERAL ST SPRING GROVE AVE STERLING RD NORFOLK AVE WARREN ST HOSPITAL RD ALLEN PL AHWAGA AVEI-91 MAPLE ST WARFIELD PL FORT ST FIRST SQUARE RD FLORENCE RD MATTHEW DR PAQUETTEAVE COLUMBUS AVE INDIAN HILL VERNON ST TARA CIR COUNTRY WAY BRISSON DR TYLER CT WILDER PL NORWOODAVE MICHELMANAVE LASEL L AVE WARNERS ROW SUMMERFIELD ST COLES MEADOW RD WHITE PINE DR KEYES ST MARYJANE LN COOKE AVE BRIGHT ST BIXBY CT HOOKER AVE THE LANE(LAURELPARK) CHESTNUT AVE ARMORY ST HAROLD ST HINCKLEY ST HEFFERNAN ST MEADOW AVE BURTS PIT RD PYNCHON MEADOW RD COSMIAN AVE GLENDALE AVE DEWEY CT EDGEWOODTERR FERRY AVE SYLVAN LN VERONA ST ISABELLA ST FORBES AVE GARFIELD ST HAMPSHIRE HTS ALLISON ST PEARL ST HOLLY CT BRIDGE RD SUMNER AVE STOWELL ST RURAL LN ELM ST INDUSTRIAL DR MARIAN ST FAIRFIELD AVE PLYMOUTH AVE ORMOND DR STRAWBERRY HILL CHESTERFIELD RD FIFTH AVE STONEWALL DR GROVE AVE FAIR ST DIAMOND CT DICKINSON ST JEWETT ST FAIR ST EX T GLENWOOD AVE MANDELLE RD FAIRWAY DR MAPLE AVE DEPOT AVE RIVERSIDE DR GREGORY LN FAIRWAY VILLAGE ACCESS REED ST SERVICE CTR RD NEW ST LOOK PARK ACCESS GROVE ST WILSON AVE PROSPECT HGTS WINTER ST CLAIRE AVE WESTHAMPTON RD FLORENCE HGTS ACCESS UPLAND RD CHARLES ST KINGSLEY AVE HATFIELD RD BIRCH HILL RD CEDAR ST SHEFFIELD LANE WEST ST PARK HI L L RD HENSHAW AVE KIRKLAND AVE OVERLOOK DR DANA ST WOODBINE AVE SCANLON AVE STRONG AVE VALLEY ST WINTERBERRY LN WINCHESTER TERR LOOK PARK ACCESS FERN ST HAYES AVE HIGHLAND AVE CHURCH ST LOOKPARKACCESS PARK ST LOOK PARK ACCESS OLD SPRINGFIELD RD WW TREATMENTPLANT MYRTLE ST BELMONT AVE EDWARDS SQ HARLOW AVE HOSPITAL RD HIGH MEADOW RD HOWES ST RUST AVE SPRUCE LN INDUSTRIAL DR AVIS CIR WEST FARMS RD ADARE PL HENRY ST LOOKPARKACCESS GRAVES AVE DENISE CT PARK HILL RD RUSTLEWOOD RIDGE LOOK PARK ACCESS BEATTIE DR LEXINGTON AVE SUMMER ST LAUREL LN LOUDVILLE RD HILLCREST DR LOOKPARKACCESS MASSASOIT ST JAMES AVE WEST CENTER ST LYMAN RD MURPHY TERR PILGRIM DR SOUTH PARK TERR ALDRICH ST O'DONNELL DR DYKE RD NORTHERN AVE LANGWORTHY RD CROSS ST BATES ST HASTINGS HGTS CHAPEL ST EMILY LN LEENO TERR BUTLER PL OLIVER ST MUNROE ST BRIERWOOD DR ROCKY HILL RD-RT 66 LINDEN ST WARNER ST GLENDALE RD HATFIELD RD BOTTOMS RD POWELL ST LONGFELLOW DR GRANDVIEW ST SOUTH MAIN ST ARLINGTON ST MANHAN ST WEST PARSONS LN FORT HILL TERR PERKINS AVE COLONEL LAVALLEY LN WINTHROP ST TERRACE LN CHESTNUT ST CLARK ST BERKSHIRE TERR LIBERTY ST SPRING STREET EXT GRANT AVE EARLE ST MAINES FIELD ACCESS LAUREL ST WINSLOW AVE PHILLIPS PL TIFFANY LN LANDY AVE I-91 PENCASAL DR SOVEREIGN WAY FAIRVIEW AVE REVELL AVE CROSS PATH RD EVERGREEN RD CLARK AVE COOLIDGE AVE MILTON ST ATWOOD DR NEW SOUTH ST-RT 10 WESTWOOD TERR STODDARD ST PRINCE ST ELLINGTON RD ROE AVE DUNPHY DR EAST CENTER ST OXBOW RD RIDGEWOOD TERR I-91 PLATINUM CIR DAY AVE GOTHIC ST NUTTING AVE LINCOLN AVE VILLONE DR CHERRY ST HAMPTON AVE TAYLOR ST GILRAIN TERR KEARNEY FIELD SHERMAN AVE BIRCH LN CROSS PATH RD WEBBS HOLLOW RD HEBERT AVE ELIZABETH ST FRUIT ST LOVEFIELD ST HAMPSHIRE HTS RAINBOW RD GOLDEN DR SANDY HILL RD CRESTVIEW DR MANN TERR MT TOM RD-RT 5 HILLSIDE RD WASHINGTON AVE DIMOCK ST CORTICELLI ST MIDD L E S T HARRISON AVE RIVERBANK RD DANKS RD KENSINGTON AVE MAIN ST STONE RIDGE DR ORCHARD ST MOUNTAIN ST I-91 CLEMENT ST DAMON RD LONGVIEW DR AUTUMN DR OLIVE ST COLLEGE LN MANHAN RD DREWSEN DR PIONEER KNOLLS LYMAN RD HATFIELD ST MAPLE RIDGE RD PINE BROOK CURVE NOO K RD BRADFORD ST HUNTS RD MAPLEWOOD TERR OLD RAINBOW RD MORNINGSIDE DR MAYNARD RD MONTAGUE RD CARLON DR FOX FARMS RD WOODLAWN AVE AUSTIN CIR TEXAS RD SPRING ST WATER ST POTASH RD GREENLEAF DR STRONGS RD MOUNTAIN LAUREL PATH LAKE ST RICK DR KINGS HWY I-91 LOOK PARK ACCESS OXBOW RD MANHAN RD HAYDENVILLE RD OLD FERRY RD SHEPARDS HOLLOW WOODS RD RYAN RD VALLEY FIELD RD FAIR ST CURTIS NOOK RD PARSONS SWAMP RD YOUNG RAINBOW RD ARCH ST WOODLAND DR LADYSLIPPER LN CROSS PATH RD DRURY LN I-91 ISLAND RD RIVER RD WALNUT TREES PATH CARDINAL WAY OLD FERRY RD OLD WILSON RD VENTURESFIELD RD AUDUBON RD EASTHAMPTON RD TURKEY HILL RD NORTH FARMS RD I-91 KENNEDY RD SYLVESTER RD I-91 ASPEN LN AMBER LN HAVEN AVE (LAUREL PARK) LOOK PARK ACCESS GOLDENCHAIN LN HEADING AVE (LAUREL PARK GOLDENCHAIN LN ALLENRD LOOKPARKACCESS E 01 2 0. 5 M i l e s 523 potential parcels using GIS analysis;51 "mapped" wells and 318 "unmapped"wells from original spreadsheet Le g e n d all_mapped_wells potential wells w/living units                   $33(1',;' ('55$',860$3'$7$%$6(5(3257   FORM-LBC-BCS ®kcehCoeGhtiwtropeR™paMsuidaRRDEehT 6 Armstrong Road, 4th floorShelton, CT 06484Toll Free: 800.352.0050www.edrnet.com 128 Rocky Hill Road 128 Rocky Hill Road Northampton, MA 01060 Inquiry Number: 4008590.2s July 16, 2014 SECTION PAGE Executive Summary ES1 Overview Map 2 Detail Map 3 Map Findings Summary4 Map Findings 7 Orphan Summary 51 Government Records Searched/Data Currency TrackingGR-1 GEOCHECK ADDENDUM Physical Setting Source AddendumA-1 Physical Setting Source SummaryA-2 Physical Setting Source MapA-7 Physical Setting Source Map FindingsA-8 Physical Setting Source Records SearchedPSGR-1 TC4008590.2s Page 1 Thank you for your business.Please contact EDR at 1-800-352-0050with any questions or comments. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental DataResources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist fromother sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTALDATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION,MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALLENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE,ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL,CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLYLIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings,environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, norshould they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase IEnvironmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for anyproperty. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2014 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in wholeor in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All othertrademarks used herein are the property of their respective owners. TABLEOFCONTENTS EXECUTIVE SUMMARY TC4008590.2s EXECUTIVE SUMMARY 1 A search of available environmental records was conducted by Environmental Data Resources, Inc (EDR).The report was designed to assist parties seeking to meet the search requirements of EPA’s Standardsand Practices for All Appropriate Inquiries (40 CFR Part 312), the ASTM Standard Practice for Environmental Site Assessments (E 1527-13) or custom requirements developed for the evaluation of environmental risk associated with a parcel of real estate. TARGET PROPERTY INFORMATION ADDRESS 128 ROCKY HILL ROADNORTHAMPTON, MA 01060 COORDINATES 42.3026000 - 42˚ 18’ 9.36’’Latitude (North): 72.6596000 - 72˚ 39’ 34.56’’Longitude (West): Zone 18Universal Tranverse Mercator: 692915.9UTM X (Meters): 4685813.0UTM Y (Meters): 246 ft. above sea levelElevation: USGS TOPOGRAPHIC MAP ASSOCIATED WITH TARGET PROPERTY 42072-C6 EASTHAMPTON, MATarget Property Map:1979Most Recent Revision: AERIAL PHOTOGRAPHY IN THIS REPORT 20120706, 20120808Portions of Photo from:USDASource: TARGET PROPERTY SEARCH RESULTS The target property was not listed in any of the databases searched by EDR. DATABASES WITH NO MAPPED SITES No mapped sites were found in EDR’s search of available ("reasonably ascertainable ") governmentrecords either on the target property or within the search radius around the target property for thefollowing databases: STANDARD ENVIRONMENTAL RECORDS Federal NPL site list NPLNational Priority List EXECUTIVE SUMMARY TC4008590.2s EXECUTIVE SUMMARY 2 Proposed NPLProposed National Priority List SitesNPL LIENSFederal Superfund Liens Federal Delisted NPL site list Delisted NPLNational Priority List Deletions Federal CERCLIS list CERCLISComprehensive Environmental Response, Compensation, and Liability Information SystemFEDERAL FACILITYFederal Facility Site Information listing Federal CERCLIS NFRAP site List CERC-NFRAPCERCLIS No Further Remedial Action Planned Federal RCRA CORRACTS facilities list CORRACTSCorrective Action Report Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDFRCRA - Treatment, Storage and Disposal Federal RCRA generators list RCRA-LQGRCRA - Large Quantity GeneratorsRCRA-SQGRCRA - Small Quantity GeneratorsRCRA-CESQGRCRA - Conditionally Exempt Small Quantity Generator Federal institutional controls / engineering controls registries US ENG CONTROLSEngineering Controls Sites ListUS INST CONTROLSites with Institutional ControlsLUCISLand Use Control Information System Federal ERNS list ERNSEmergency Response Notification System State and tribal leaking storage tank lists LUSTLeaking Underground Storage Tank ListingLASTLeaking Aboveground Storage Tank SitesINDIAN LUSTLeaking Underground Storage Tanks on Indian Land State and tribal registered storage tank lists INDIAN USTUnderground Storage Tanks on Indian LandFEMA USTUnderground Storage Tank Listing State and tribal institutional control / engineering control registries INST CONTROLSites With Activity and Use Limitation State and tribal voluntary cleanup sites INDIAN VCPVoluntary Cleanup Priority Listing EXECUTIVE SUMMARY TC4008590.2s EXECUTIVE SUMMARY 3 State and tribal Brownfields sites BROWNFIELDSCompleted Brownfields Covenants Listing ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDSA Listing of Brownfields Sites Local Lists of Landfill / Solid Waste Disposal Sites DEBRIS REGION 9Torres Martinez Reservation Illegal Dump Site LocationsODIOpen Dump InventoryINDIAN ODIReport on the Status of Open Dumps on Indian Lands Local Lists of Hazardous waste / Contaminated Sites US CDLClandestine Drug LabsUS HIST CDLNational Clandestine Laboratory Register Local Land Records LIENS 2CERCLA Lien InformationLIENSLiens Information Listing Records of Emergency Release Reports HMIRSHazardous Materials Information Reporting SystemSPILLSHistorical Spill ListRELEASEReportable Releases DatabaseSPILLS 80SPILLS 80 data from FirstSearchSPILLS 90SPILLS 90 data from FirstSearch Other Ascertainable Records DOT OPSIncident and Accident DataDODDepartment of Defense SitesFUDSFormerly Used Defense SitesCONSENTSuperfund (CERCLA) Consent DecreesRODRecords Of DecisionUMTRAUranium Mill Tailings SitesUS MINESMines Master Index FileTRISToxic Chemical Release Inventory SystemTSCAToxic Substances Control ActFTTSFIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act)HIST FTTSFIFRA/TSCA Tracking System Administrative Case ListingSSTSSection 7 Tracking SystemsICISIntegrated Compliance Information SystemPADSPCB Activity Database SystemMLTSMaterial Licensing Tracking SystemRADINFORadiation Information Database EXECUTIVE SUMMARY TC4008590.2s EXECUTIVE SUMMARY 4 FINDSFacility Index System/Facility Registry SystemRAATSRCRA Administrative Action Tracking SystemRMPRisk Management PlansNPDESNPDES Permit ListingDRYCLEANERSRegulated Drycleaning FacilitiesENFEnforcement Action CasesAIRSPermitted Facilities ListingTIER 2Tier 2 Information ListingLEADLead Inspection DatabaseINDIAN RESERVIndian ReservationsSCRD DRYCLEANERSState Coalition for Remediation of Drycleaners ListingLEAD SMELTERSLead Smelter SitesPRPPotentially Responsible PartiesEPA WATCH LISTEPA WATCH LISTCOAL ASH DOESteam-Electric Plant Operation DataGWDPGround Water Discharge PermitsFinancial AssuranceFinancial Assurance Information ListingCOAL ASH EPACoal Combustion Residues Surface Impoundments ListMERCURYMercury Product Recyling Drop-Off Locations Listing2020 COR ACTION2020 Corrective Action Program ListTSDTSD FacilityUS FIN ASSURFinancial Assurance InformationUS AIRSAerometric Information Retrieval System Facility SubsystemPCB TRANSFORMERPCB Transformer Registration Database EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records EDR MGPEDR Proprietary Manufactured Gas PlantsEDR US Hist Auto StatEDR Exclusive Historic Gas StationsEDR US Hist CleanersEDR Exclusive Historic Dry Cleaners EDR RECOVERED GOVERNMENT ARCHIVES Exclusive Recovered Govt. Archives RGA HWSRecovered Government Archive State Hazardous Waste Facilities ListRGA LUSTRecovered Government Archive Leaking Underground Storage Tank SURROUNDING SITES: SEARCH RESULTS Surrounding sites were identified in the following databases. Elevations have been determined from the USGS Digital Elevation Model and should be evaluated ona relative (not an absolute) basis. Relative elevation information between sites of close proximityshould be field verified. Sites with an elevation equal to or higher than the target property have beendifferentiated below from sites with an elevation lower than the target property. Page numbers and map identification numbers refer to the EDR Radius Map report where detailed data on individual sites can be reviewed. Sites listed in bold italics are in multiple databases. Unmappable (orphan) sites are not considered in the foregoing analysis. EXECUTIVE SUMMARY TC4008590.2s EXECUTIVE SUMMARY 5 STANDARD ENVIRONMENTAL RECORDS State- and tribal - equivalent CERCLIS SHWS:Contains information on releases of oil and hazardous materials that have been reported toDEP. A review of the SHWS list, as provided by EDR, and dated 04/11/2014 has revealed that there are 6 SHWS sites within approximately 1 mile of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ _____________________________ HAMPSHIRE COUNTY JAIL 205 ROCKY HILL RDNW 1/8 - 1/4 (0.249 mi.)B49 Release Tracking Number / Current Status: 1-0015141 / RAO PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ _____________________________ GASOLINE STATION 54 EASTHAMPTON RDENE 1/2 - 1 (0.555 mi.)517 Release Tracking Number / Current Status: 1-0017408 / RAO Release Tracking Number / Current Status: 1-0010164 / RAO BACON PROPERTY 14 EASTHAMPTON STENE 1/2 - 1 (0.646 mi.)638 Release Tracking Number / Current Status: 1-0000358 / DEPNFA ALLEN & SONS INC EASTHAMPTON RDENE 1/2 - 1 (0.673 mi.)739 Release Tracking Number / Current Status: 1-0000549 / PENNFA N/A 375 SOUTH STREETENE 1/2 - 1 (0.850 mi.)841 Release Tracking Number / Current Status: 1-0019243 / RAO O’CONNELL OIL 25 TEXAS RDENE 1/2 - 1 (0.941 mi.)943 Release Tracking Number / Current Status: 1-0016611 / RAO State and tribal landfill and/or solid waste disposal site lists SWF/LF:The Solid Waste Facilities/Landfill Sites records typically contain an inventory of solidwaste disposal facilities or landfills in a particular state. The data come from the Department ofEnvironmental Protection’s Solid Waste Facility Database/Transfer Stations. A review of the SWF/LF list, as provided by EDR, and dated 02/27/2014 has revealed that there is 1 SWF/LF site within approximately 0.5 miles of the target property. PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ _____________________________ NORTHAMPTON EASTHAMPTON ROAD L 234 EASTHAMPTON RDESE 1/8 - 1/4 (0.227 mi.)A27 State and tribal registered storage tank lists UST:The Underground Storage Tank database contains registered USTs. USTs are regulated underSubtitle I of the Resource Conservation and Recovery Act (RCRA). The data come from the Department ofEnvironmental Protection’s Summary Listing of all the Tanks Registered in the State of Massachusetts. A review of the UST list, as provided by EDR, and dated 04/18/2014 has revealed that there is 1 UST EXECUTIVE SUMMARY TC4008590.2s EXECUTIVE SUMMARY 6 site within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ _____________________________ HAMPSHIRE COUNTY JAIL 205 ROCKY HILL RDNW 1/8 - 1/4 (0.249 mi.)B49 Facility Id: 30091 AST:The Aboveground Storage Tank database contains registered ASTs. The data come from theDepartment of Environmental Protection’s Summary Listing of all the Tanks Registered in the State ofMassachusetts. A review of the AST list, as provided by EDR, and dated 10/22/2009 has revealed that there is 1 AST site within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ _____________________________ HAMPSHIRE COUNTY JAIL 205 ROCKY HILL RDNW 1/8 - 1/4 (0.249 mi.)B49 Release Tracking Number: 30091 ADDITIONAL ENVIRONMENTAL RECORDS Other Ascertainable Records RCRA NonGen / NLR: RCRAInfo is EPA’s comprehensive information system, providing access to data supportingthe Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA)of 1984. The database includes selective information on sites which generate, transport, store, treat and/ordispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators donot presently generate hazardous waste. A review of the RCRA NonGen / NLR list, as provided by EDR, and dated 03/11/2014 has revealed that there is 1 RCRA NonGen / NLR site within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ _____________________________ HAMPSHIRE COUNTY JAIL 205 ROCKY HILL RDNW 1/8 - 1/4 (0.249 mi.)B49 HW GEN: Permanent generator identification numbers for all Massachusetts generators of hazardouswaste and waste oil that have registered with or notified MassDEP of their hazardous waste activities. A review of the HW GEN list, as provided by EDR, and dated 03/24/2014 has revealed that there are 2 HW GEN sites within approximately 0.25 miles of the target property. PageMap IDDirection / Distance Address Equal/Higher Elevation ____________________ ________ _____________________________ HAMPSHIRE COUNTY JAIL 205 ROCKY HILL RDNW 1/8 - 1/4 (0.249 mi.)B39 PageMap IDDirection / Distance Address Lower Elevation ____________________ ________ _____________________________ VALLEY RECYCLING 234 EASTHAMPTON RDESE 1/8 - 1/4 (0.227 mi.)A17 EXECUTIVE SUMMARY TC4008590.2s EXECUTIVE SUMMARY 7 Due to poor or inadequate address information, the following sites were not mapped. Count: 20 records. Site Name Database(s)____________ ____________ NO LOCATION AID SHWS, RELEASE OXBOW STATE BOAT RAMP SHWS, RELEASE NO LOCATION AID SHWS, RELEASE LOWER MILL POND SHWS, RELEASE TTU ACCIDENT SHWS, RELEASE POLE 188/44 SHWS, RELEASE NORTH OF EXIT 18 SHWS, RELEASE MM 21 SHWS, RELEASE BRIDGE OVER OXBOW SHWS, RELEASE POLE #1 SHWS, RELEASE MM 23.5 SHWS, RELEASE MILE 23.3 SHWS, RELEASE POLE 4-03 SHWS, RELEASE POLE #7 SHWS, RELEASE MA HIGHWAY #20 SHWS, RELEASE POLE #18 58 SHWS, RELEASE WESTHAMPTON LANDFILL FINDS, SWF/LF, ENF NORTHAMPTON STATE HOSPITAL DUMP SWF/LF MULTI FAMILY RESIDENCE LUST, RELEASE RYAN ROAD ELEMENTARY FINDS EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. 0 EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. 0 MAP FINDINGS SUMMARY Search TargetDistance TotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted STANDARD ENVIRONMENTAL RECORDS Federal NPL site list 0 NR 0 0 0 0 1.000NPL 0 NR 0 0 0 0 1.000Proposed NPL 0 NR NR NR NR NR TPNPL LIENS Federal Delisted NPL site list 0 NR 0 0 0 0 1.000Delisted NPL Federal CERCLIS list 0 NR NR 0 0 0 0.500CERCLIS 0 NR NR 0 0 0 0.500FEDERAL FACILITY Federal CERCLIS NFRAP site List 0 NR NR 0 0 0 0.500CERC-NFRAP Federal RCRA CORRACTS facilities list 0 NR 0 0 0 0 1.000CORRACTS Federal RCRA non-CORRACTS TSD facilities list 0 NR NR 0 0 0 0.500RCRA-TSDF Federal RCRA generators list 0 NR NR NR 0 0 0.250RCRA-LQG 0 NR NR NR 0 0 0.250RCRA-SQG 0 NR NR NR 0 0 0.250RCRA-CESQG Federal institutional controls /engineering controls registries 0 NR NR 0 0 0 0.500US ENG CONTROLS 0 NR NR 0 0 0 0.500US INST CONTROL 0 NR NR 0 0 0 0.500LUCIS Federal ERNS list 0 NR NR NR NR NR TPERNS State- and tribal - equivalent CERCLIS 6 NR 5 0 1 0 1.000SHWS State and tribal landfill and/orsolid waste disposal site lists 1 NR NR 0 1 0 0.500SWF/LF State and tribal leaking storage tank lists 0 NR NR 0 0 0 0.500LUST 0 NR NR 0 0 0 0.500LAST 0 NR NR 0 0 0 0.500INDIAN LUST State and tribal registered storage tank lists 1 NR NR NR 1 0 0.250UST TC4008590.2s Page 4 MAP FINDINGS SUMMARY Search TargetDistance TotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted 1 NR NR NR 1 0 0.250AST 0 NR NR NR 0 0 0.250INDIAN UST 0 NR NR NR 0 0 0.250FEMA UST State and tribal institutionalcontrol / engineering control registries 0 NR NR 0 0 0 0.500INST CONTROL State and tribal voluntary cleanup sites 0 NR NR 0 0 0 0.500INDIAN VCP State and tribal Brownfields sites 0 NR NR 0 0 0 0.500BROWNFIELDS ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists 0 NR NR 0 0 0 0.500US BROWNFIELDS Local Lists of Landfill / SolidWaste Disposal Sites 0 NR NR 0 0 0 0.500DEBRIS REGION 9 0 NR NR 0 0 0 0.500ODI 0 NR NR 0 0 0 0.500INDIAN ODI Local Lists of Hazardous waste /Contaminated Sites 0 NR NR NR NR NR TPUS CDL 0 NR NR NR NR NR TPUS HIST CDL Local Land Records 0 NR NR NR NR NR TPLIENS 2 0 NR NR NR NR NR TPLIENS Records of Emergency Release Reports 0 NR NR NR NR NR TPHMIRS 0 NR NR NR NR NR TPSPILLS 0 NR NR NR NR NR TPRELEASE 0 NR NR NR NR NR TPSPILLS 80 0 NR NR NR NR NR TPSPILLS 90 Other Ascertainable Records 1 NR NR NR 1 0 0.250RCRA NonGen / NLR 0 NR NR NR NR NR TPDOT OPS 0 NR 0 0 0 0 1.000DOD 0 NR 0 0 0 0 1.000FUDS 0 NR 0 0 0 0 1.000CONSENT 0 NR 0 0 0 0 1.000ROD 0 NR NR 0 0 0 0.500UMTRA 0 NR NR NR 0 0 0.250US MINES TC4008590.2s Page 5 MAP FINDINGS SUMMARY Search TargetDistance TotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted 0 NR NR NR NR NR TPTRIS 0 NR NR NR NR NR TPTSCA 0 NR NR NR NR NR TPFTTS 0 NR NR NR NR NR TPHIST FTTS 0 NR NR NR NR NR TPSSTS 0 NR NR NR NR NR TPICIS 0 NR NR NR NR NR TPPADS 0 NR NR NR NR NR TPMLTS 0 NR NR NR NR NR TPRADINFO 0 NR NR NR NR NR TPFINDS 0 NR NR NR NR NR TPRAATS 0 NR NR NR NR NR TPRMP 0 NR NR NR NR NR TPNPDES 0 NR NR NR 0 0 0.250DRYCLEANERS 0 NR NR NR NR NR TPENF 0 NR NR NR NR NR TPAIRS 0 NR NR NR NR NR TPTIER 2 0 NR NR NR NR NR TPLEAD 0 NR 0 0 0 0 1.000INDIAN RESERV 0 NR NR 0 0 0 0.500SCRD DRYCLEANERS 0 NR NR NR NR NR TPLEAD SMELTERS 0 NR NR NR NR NR TPPRP 0 NR NR NR NR NR TPEPA WATCH LIST 0 NR NR NR NR NR TPCOAL ASH DOE 0 NR NR NR NR NR TPGWDP 0 NR NR NR NR NR TPFinancial Assurance 0 NR NR 0 0 0 0.500COAL ASH EPA 2 NR NR NR 2 0 0.250HW GEN 0 NR NR 0 0 0 0.500MERCURY 0 NR NR NR 0 0 0.2502020 COR ACTION 0 NR NR 0 0 0 0.500TSD 0 NR NR NR NR NR TPUS FIN ASSUR 0 NR NR NR NR NR TPUS AIRS 0 NR NR NR NR NR TPPCB TRANSFORMER EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records 0 NR 0 0 0 0 1.000EDR MGP 0 NR NR NR 0 0 0.250EDR US Hist Auto Stat 0 NR NR NR 0 0 0.250EDR US Hist Cleaners EDR RECOVERED GOVERNMENT ARCHIVES Exclusive Recovered Govt. Archives 0 NR NR NR NR NR TPRGA HWS 0 NR NR NR NR NR TPRGA LUST NOTES: TP = Target Property NR = Not Requested at this Search Distance Sites may be listed in more than one database TC4008590.2s Page 6 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation SQG-MAState Generator Status: Not reportedRCRA Generator Status: MV4135874279EPA Id: HW GEN: 1201 ft.Site 1 of 2 in cluster A 0.227 mi. Relative:Lower Actual:135 ft. 1/8-1/4NORTHAMPTON, MA 01060 ESE234 EASTHAMPTON RD N/A A1 HW GENVALLEY RECYCLING S113410228 VRA PROPERTY LLCOrg That Pays Any Annual Compliance Fee And/Or Permittee: WERegion: 0214.008Numeric-Only Portion Of The Identification Code: SL0214.008Alpha-Numeric Identification Code: NORTHAMPTONMunicipality That The Operation Is Located In: Not LinedLandfills Liner: MSWLand Disposal Only, Category Waste Disposed: CappedLand Disposal Closure Status: 1972Inactive Year: WEST SPRINGFIELD, MA 01090Contacts Mailing City, State, Zip: 115 WAYSIDE AVEContact Mailing Street Address: Not reportedContact Phone Including Extension: RICHARD GAGNON, PRESIDENTContact Persons Name And Title: PrivateContacts Organization Type: COMMERCIAL DISPOSAL COMPANYName Of The Organization: 2008Close Year: Closed Landfill with Env Monitoring RequiredDescription Of The Last Classification: CLFCurrent Or Most Recent Closed Classification: Land DisposalClassification Group: 1902Active Year: 9.3000001907348633Acres: Not reportedNote On The Physical Location Of The Site: Not reportedDays of Operation: Not reportedReg Obj Acct ID Num For Each Solid Waste Operation: Not reportedAnnual Tons for 2011: Not reportedAnnual Tons for 2010: Not reportedAnnual Tons for 2009: Not reportedAnnual Tons for 2008: Not reportedAnnual Tons for 2007: Not reportedAnnual Tons for 20006: Not reportedAnnual Tons for 2005: Not reportedAnnual Tons for 2004: Not reportedAnnual Tons for 2003: Not reportedAnnual Tons for 2002: Not reportedAnnual Tons for 2001: Not reportedAnnual Tons for 2000: Not reportedAnnual Tons for 1999: Not reportedAnnual Tons for 1998: Not reportedAnnual Tons for 1997: Not reportedAnnual Tons for 1996: Not reportedAnnual Tons for 1995: Not reportedFacility Phone: LF: 1201 ft.Site 2 of 2 in cluster A 0.227 mi. Relative:Lower Actual:135 ft. 1/8-1/4NORTHAMPTON, MA 01060 ESE ENF234 EASTHAMPTON RD N/A A2 SWF/LFNORTHAMPTON EASTHAMPTON ROAD LANDFILLS105590521 TC4008590.2s Page 7 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation ActiveCurrent Operational Status: 150Maximum Permitted Tons Per Day: Not reportedResponsible Party Telephone Inc Extension: NORTH HATFIELD, MA 01066Responsible Party Mailing City, State, Zip: Not reportedResponsible Party Mailing Street Address Line 2: PO BOX 12Responsible Party Mailing Street Address Line 1: PrivateResponsible Party Organization Type: VOLUME RECYCLING ASSOCIATES INCOrg That Pays Any Annual Compliance Fee And/Or Permittee: WERegion: 0214.007Numeric-Only Portion Of The Identification Code: TR0214.007Alpha-Numeric Identification Code: NORTHAMPTONMunicipality That The Operation Is Located In: n/aLandfills Liner: n/aLand Disposal Only, Category Waste Disposed: n/aLand Disposal Closure Status: Not reportedInactive Year: HATFIELD, MA 01038Contacts Mailing City, State, Zip: 129 ELM STContact Mailing Street Address: (413)586-4100Contact Phone Including Extension: RICHARD CARNALL, MANGERContact Persons Name And Title: PrivateContacts Organization Type: VOLUME RECYCLING ASSOCIATES INCName Of The Organization: Not reportedClose Year: Large Transfer StationDescription Of The Last Classification: LGTRANCurrent Or Most Recent Closed Classification: Handling/TransferClassification Group: 1988Active Year: Not reportedAcres: ROUTE 5Note On The Physical Location Of The Site: 302Days of Operation: 302Reg Obj Acct ID Num For Each Solid Waste Operation: Not reportedAnnual Tons for 2011: Not reportedAnnual Tons for 2010: Not reportedAnnual Tons for 2009: Not reportedAnnual Tons for 2008: Not reportedAnnual Tons for 2007: 0Annual Tons for 20006: Not reportedAnnual Tons for 2005: Not reportedAnnual Tons for 2004: Not reportedAnnual Tons for 2003: 6916Annual Tons for 2002: 29348Annual Tons for 2001: 28569Annual Tons for 2000: 3184Annual Tons for 1999: 2681Annual Tons for 1998: Not reportedAnnual Tons for 1997: 26687Annual Tons for 1996: 13556Annual Tons for 1995: (413)586-4100Facility Phone: ClosedCurrent Operational Status: Not reportedMaximum Permitted Tons Per Day: Not reportedResponsible Party Telephone Inc Extension: HATFIELD, MA 01038Responsible Party Mailing City, State, Zip: Not reportedResponsible Party Mailing Street Address Line 2: 129 ELM STResponsible Party Mailing Street Address Line 1: PrivateResponsible Party Organization Type: NORTHAMPTON EASTHAMPTON ROAD LANDFILL (Continued)S105590521 TC4008590.2s Page 8 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Solid WasteProg: Not reportedComments: WASTE MANAGEMENT OF MASSSecond Name: ACOP-WE-02-4002Facility ID: 2002-08-08 00:00:00Issue Date: WEReg: SOUTH HADLEY, MA 01075Address 2: 600 NEW LUDLOW RDAddress 1: COMMERCIAL DISPOSAL CO, INCName: ACOPFacility Type: ACOP-WE-02-4002Facility ID: MA ENFORCEMENT : NORTHAMPTON EASTHAMPTON ROAD LANDFILL (Continued)S105590521 Not reportedState Generator Status: VSQGRCRA Generator Status: MAD982203424EPA Id: HW GEN: 1317 ft.Site 1 of 2 in cluster B 0.249 mi. Relative:Higher Actual:253 ft. 1/8-1/4NORTHAMPTON, MA 01060 NW205 ROCKY HILL RD N/A B3 HW GENHAMPSHIRE COUNTY JAIL S113409817 NORTHMAPTON, MA 01060 205 ROCKY HILL RDOwner/operator address: COMM OF MASSOwner/operator name: Owner/Operator Summary: Handler: Non-Generators do not presently generate hazardous wasteDescription: Non-GeneratorClassification: PrivateLand type: 01EPA Region: Not reportedContact email: (413) 584-5911Contact telephone: USContact country: NORTHMAPTON, MA 01060 205 ROCKY HILL RDContact address: WALLACE HLAVAContact: MAD982203424EPA ID: NORTHAMPTON, MA 01060 205 ROCKY HILL RDFacility address: HAMPSHIRE COUNTY JAILFacility name: 03/30/1987Date form received by agency: RCRA NonGen / NLR: US AIRS Financial Assurance RELEASE 1317 ft.ASTSite 2 of 2 in cluster B 0.249 mi.UST Relative:Higher Actual:253 ft. 1/8-1/4 SHWSNORTHAMPTON, MA 01060 NW FINDS205 ROCKY HILL RD MAD982203424 B4 RCRA NonGen / NLRHAMPSHIRE COUNTY JAIL 1000349816 TC4008590.2s Page 9 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reported Proposed penalty amount: State Enforcement lead agency: Not reported Enf. disp. status date: Not reported Enf. disposition status: 11/16/1988 Enforcement action date: WRITTEN INFORMAL Enforcement action: StateViolation lead agency: 11/10/1993Date achieved compliance: 11/10/1988Date violation determined: Generators - GeneralArea of violation: SR - 801Regulation violated: Facility Has Received Notices of Violations: WHICH WOULD BE CONSIDERED AS IGNITABLE HAZARDOUS WASTE. MATERIAL. LACQUER THINNER IS AN EXAMPLE OF A COMMONLY USED SOLVENT WHICH CAN BE OBTAINED FROM THE MANUFACTURER OR DISTRIBUTOR OF THE FLASH POINT OF A WASTE IS TO REVIEW THE MATERIAL SAFETY DATA SHEET, CLOSED CUP FLASH POINT TESTER. ANOTHER METHOD OF DETERMINING THE LESS THAN 140 DEGREES FAHRENHEIT AS DETERMINED BY A PENSKY-MARTENS IGNITABLE HAZARDOUS WASTES ARE THOSE WASTES WHICH HAVE A FLASHPOINT OFWaste name: D001Waste code: Hazardous Waste Summary: NoUsed oil transporter: NoUsed oil transfer facility: NoUsed oil Specification marketer: NoUsed oil fuel marketer to burner: NoUser oil refiner: NoUsed oil processor: NoUsed oil fuel burner: NoFurnace exemption: NoOn-site burner exemption: NoUnderground injection activity: NoTreater, storer or disposer of HW: NoTransporter of hazardous waste: NoRecycler of hazardous waste: NoMixed waste (haz. and radioactive): NoU.S. importer of hazardous waste: Handler Activities Summary: Not reportedOwner/Op end date: 03/01/1990Owner/Op start date: OperatorOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator telephone: USOwner/operator country: NORTHMAPTON, MA 01060 205 ROCKY HILL RDOwner/operator address: HAMP COUNTY JAILOwner/operator name: Not reportedOwner/Op end date: 10/16/2004Owner/Op start date: OwnerOwner/Operator Type: PrivateLegal status: Not reportedOwner/operator telephone: USOwner/operator country: HAMPSHIRE COUNTY JAIL (Continued)1000349816 TC4008590.2s Page 10 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Environmental Interest/Information System 110003480457Registry ID: FINDS: StateEvaluation lead agency: 11/10/1993Date achieved compliance: Generators - GeneralArea of violation: COMPLIANCE EVALUATION INSPECTION ON-SITEEvaluation: 11/10/1988Evaluation date: Evaluation Action Summary: Not reported Paid penalty amount: Not reported Final penalty amount: Not reported Proposed penalty amount: State Enforcement lead agency: Not reported Enf. disp. status date: Not reported Enf. disposition status: 11/16/1988 Enforcement action date: WRITTEN INFORMAL Enforcement action: StateViolation lead agency: 11/10/1993Date achieved compliance: 11/10/1988Date violation determined: Generators - GeneralArea of violation: SR - 061(1)Regulation violated: Not reported Paid penalty amount: Not reported Final penalty amount: Not reported Proposed penalty amount: State Enforcement lead agency: Not reported Enf. disp. status date: Not reported Enf. disposition status: 11/16/1988 Enforcement action date: WRITTEN INFORMAL Enforcement action: StateViolation lead agency: 11/10/1993Date achieved compliance: 11/10/1988Date violation determined: Generators - GeneralArea of violation: SR - 21CRegulation violated: Not reported Paid penalty amount: Not reported Final penalty amount: Not reported Proposed penalty amount: State Enforcement lead agency: Not reported Enf. disp. status date: Not reported Enf. disposition status: 11/16/1988 Enforcement action date: WRITTEN INFORMAL Enforcement action: StateViolation lead agency: 11/10/1993Date achieved compliance: 11/10/1988Date violation determined: Generators - GeneralArea of violation: SR - 351(10)(c)Regulation violated: Not reported Paid penalty amount: Not reported Final penalty amount: HAMPSHIRE COUNTY JAIL (Continued)1000349816 TC4008590.2s Page 11 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation to background or a threat of release has been eliminated. A permanent solution has been achieved. Contamination has been reducedResponse Action Outcome: 12/22/2003Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: to background or a threat of release has been eliminated. A permanent solution has been achieved. Contamination has been reducedResponse Action Outcome: 12/22/2003Action Date: Oral Approval of Plan or ActionAction Status: Immediate Response ActionAction Type: Actions: 30 gallonsQuantity: DIESELChemical: Chemicals: Click here to access the MA DEP site for this facility: VEHICLESource: STATELocation Type: Not reportedOil Or Haz Material: reduced to background or a threat of release has been eliminated. A1 - A permanent solution has been achieved. Contamination has beenResponse Action Outcome: Not reportedPhase: 02/27/2004Status Date: Response Action OutcomeCurrent Status: Not reportedAssociated ID: TWO HRCategory: 12/22/2003Notification Date: NORTHAMPTONRelease Town: 1-0015141 / RAORelease Tracking Number/Current Status: SHWS: System MA-EPICS - Massachussetts Environmental Protection Integrated Computer corrective action activities required under RCRA. program staff to track the notification, permit, compliance, and and treat, store, or dispose of hazardous waste. RCRAInfo allows RCRA events and activities related to facilities that generate, transport, Conservation and Recovery Act (RCRA) program through the tracking of RCRAInfo is a national information system that supports the Resource of the Clean Air Act. redesign to support facility operating permits required under Title V estimation of total national emissions. AFS is undergoing a major to comply with regulatory programs and by EPA as an input for the AFS data are utilized by states to prepare State Implementation Plans used to track emissions and compliance data from industrial plants. information concerning airborne pollution in the United States. AFS is Aerometric Data (SAROAD). AIRS is the national repository for National Emission Data System (NEDS), and the Storage and Retrieval of Subsystem) replaces the former Compliance Data System (CDS), the AFS (Aerometric Information Retrieval System (AIRS) Facility HAMPSHIRE COUNTY JAIL (Continued)1000349816 TC4008590.2s Page 12 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 2Tank ID: NoAbove Ground: Interstitial Space MonitorPipe Leak Detection: 1 WallPipe Container: SteelPipe Material: Interstitial MonitoringTank Leak Detection: ReinforcedTank Material: MVTank Usage: 2 WallsTank Type: GasolineContents: 4000Capacity: 07/24/1990Date Installed: Not reportedStatus Date: In UseTank Status: Not reportedSerial Number: 1Tank ID: 05/29/2013Date of Inspection: 15214Fire Dept. ID: JailDescription: (413) 584-5911Telephone: NORTHAMPTON, MA 01060Owner City,St,Zip: 205 ROCKY HILL RDOwner Address: HAMPSHIRE SHERIFFS OFFICEOwner: 2956Owner Id: 30091Facility ID: Facility: UST: to background or a threat of release has been eliminated. A permanent solution has been achieved. Contamination has been reducedResponse Action Outcome: 2/27/2004Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: to background or a threat of release has been eliminated. A permanent solution has been achieved. Contamination has been reducedResponse Action Outcome: 2/27/2004Action Date: Reportable Release under MGL 21EAction Status: RNFAction Type: to background or a threat of release has been eliminated. A permanent solution has been achieved. Contamination has been reducedResponse Action Outcome: 12/22/2003Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: to background or a threat of release has been eliminated. A permanent solution has been achieved. Contamination has been reducedResponse Action Outcome: 12/22/2003Action Date: FLDD1AAction Status: RLFAAction Type: HAMPSHIRE COUNTY JAIL (Continued)1000349816 TC4008590.2s Page 13 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation JailDescription: (413) 584-5911Telephone: NORTHAMPTON, MA 01060Owner City,St,Zip: 205 ROCKY HILL RDOwner Address: HAMPSHIRE SHERIFFS OFFICEOwner: 2956Owner Id: 30091Facility ID: AST: NoAbove Ground: Not reportedPipe Leak Detection: 1 WallPipe Container: SteelPipe Material: Not reportedTank Leak Detection: SteelTank Material: GeneratorTank Usage: 1 WallTank Type: Fuel OilContents: 12000Capacity: 01/01/1984Date Installed: Not reportedStatus Date: In UseTank Status: Not reportedSerial Number: 5Tank ID: NoAbove Ground: Interstitial Space MonitorPipe Leak Detection: 1 WallPipe Container: SteelPipe Material: Interstitial MonitoringTank Leak Detection: ReinforcedTank Material: Not reportedTank Usage: 2 WallsTank Type: Waste OilContents: 550Capacity: 07/24/1990Date Installed: Not reportedStatus Date: In UseTank Status: Not reportedSerial Number: 3Tank ID: NoAbove Ground: Interstitial Space MonitorPipe Leak Detection: 1 WallPipe Container: SteelPipe Material: Interstitial MonitoringTank Leak Detection: ReinforcedTank Material: MVTank Usage: 2 WallsTank Type: DieselContents: 550Capacity: 07/24/1990Date Installed: Not reportedStatus Date: In UseTank Status: Not reportedSerial Number: HAMPSHIRE COUNTY JAIL (Continued)1000349816 TC4008590.2s Page 14 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 922140North Am. industrial classf: Not reportedSic code desc: Not reportedSic code: 042Air quality cntrl region: Not reportedDunn & Bradst #: 01Region code: PIONEER VALLEYCounty: NORTHAMPTON, MA 010600000 205 ROCKY HILL ROADPlant address: HAMPSHIRE COUNTY JAILPlant name: 110003480457EPA plant ID: Airs Minor Details: AIRS (AFS): (413) 584-5911Work Phone: JailDescription: 30091Facility Id: MA Financial Assurance 2: Click here to access the MA DEP site for this facility: Not reportedOil / Haz Material Type: reduced to background or a threat of release has been eliminated. A1 - A permanent solution has been achieved. Contamination has beenResponse Action Outcome: Not reportedPhase: 02/27/2004Status Date: TWO HRCategory: 12/22/2003Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0015141 / RAORelease Tracking Number/Current Status: Release: YesAboveground: Not reportedPipe Leak Detection: 1 WallPipe Construction: SteelPipe Material: Not reportedTank Leak Detection: 1 WallTank Construction: SteelTank Material: GeneratorTank Use: Fuel OilContents: 800Capacity: In UseTank Status: Not reportedSerial Number: 4Tank ID: Tank Info: 1Spill Prevention: 1Overfill Prevention: George NiceInspector: 7/19/2007Date of Inspection: 15214Fire Dept. ID: HAMPSHIRE COUNTY JAIL (Continued)1000349816 TC4008590.2s Page 15 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1204Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1202Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1201Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1103Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1101Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1004Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1301Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1203Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1104Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1102Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: Historical Compliance Minor Sources: Not reportedPenalty amount: Not reportedDate achieved: Not reportedNational action type: Not reportedAir program: Compliance and Enforcement Major Issues: Not reportedCurrent HPV: LOCAL GOVERNMENT ALL OTHER FACILITIES NOT OWNED OR OPERATED BY A FEDERAL, STATE, ORGovt facility: POTENTIAL UNCONTROLLED EMISSIONS < 100 TONS/YEARDefault classification: IN COMPLIANCE - CERTIFICATIONDefault compliance status: Correctional InstitutionsNAIC code description: HAMPSHIRE COUNTY JAIL (Continued)1000349816 TC4008590.2s Page 16 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedTurnover compliance: Not reportedRepeat violator date: ATTAINMENT AREA FOR GIVEN POLLUTANTDef. attainment/non attnmnt: IN COMPLIANCE - CERTIFICATIONDef. poll. compliance status: POTENTIAL UNCONTROLLED EMISSIONS < 100 TONS/YEARDefault pollutant classification: Not reportedPlant air program pollutant: SIP SOURCEAir program code: Compliance & Violation Data by Minor Sources: SIP SOURCEAir prog code hist file: 1303Hist compliance date: IN COMPLIANCE - CERTIFICATIONState compliance status: SIP SOURCEAir prog code hist file: 1302Hist compliance date: HAMPSHIRE COUNTY JAIL (Continued)1000349816 Significant Risk exists. Remedial actions have not been conducted because a level of NoResponse Action Outcome: 4/10/2009Action Date: Transmittal, Notice, or Notification ReceivedAction Status: RNFEAction Type: Significant Risk exists. Remedial actions have not been conducted because a level of NoResponse Action Outcome: 2/9/2010Action Date: ALSENTAction Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: Actions: 463 milligrams per kilogramQuantity: LEADChemical: Chemicals: Click here to access the MA DEP site for this facility: PRIVPROPLocation Type: COMMERCIALLocation Type: Hazardous MaterialOil Or Haz Material: Significant Risk exists. B1 - Remedial actions have not been conducted because a level of NoResponse Action Outcome: Not reportedPhase: 04/16/2010Status Date: Response Action OutcomeCurrent Status: Not reportedAssociated ID: 120 DYCategory: 04/10/2009Notification Date: NORTHAMPTONRelease Town: 1-0017408 / RAORelease Tracking Number/Current Status: SHWS: 2929 ft. 0.555 mi. Relative:Lower Actual:116 ft. 1/2-1 RELEASENORTHAMPTON, MA 01060 ENE LUST54 EASTHAMPTON RD N/A 5 SHWSGASOLINE STATION S105198660 TC4008590.2s Page 17 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 1/10/1994Action Date: Oral Approval of Plan or ActionAction Status: Immediate Response ActionAction Type: Actions: Not reportedQuantity: GASOLINEChemical: Chemicals: Click here to access the MA DEP site for this facility: USTSource: UNKNOWNSource: COMMERCIALLocation Type: OilOil Or Haz Material: C2 - C2Response Action Outcome: PHASE VPhase: 08/04/2010Status Date: Response Action OutcomeCurrent Status: Not reportedAssociated ID: 72 HRCategory: 01/10/1994Notification Date: NORTHAMPTONRelease Town: 1-0010164 / RAORelease Tracking Number/Current Status: Significant Risk exists. Remedial actions have not been conducted because a level of NoResponse Action Outcome: 6/29/2010Action Date: Level I - Technical Screen AuditAction Status: Response Action Outcome - RAOAction Type: Significant Risk exists. Remedial actions have not been conducted because a level of NoResponse Action Outcome: 5/29/2009Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: Significant Risk exists. Remedial actions have not been conducted because a level of NoResponse Action Outcome: 4/21/2010Action Date: Fee Received - FMCRA Use OnlyAction Status: Response Action Outcome - RAOAction Type: Significant Risk exists. Remedial actions have not been conducted because a level of NoResponse Action Outcome: 4/16/2010Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: Significant Risk exists. Remedial actions have not been conducted because a level of NoResponse Action Outcome: 4/10/2009Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 18 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Reportable Release under MGL 21EAction Status: RNFAction Type: C2Response Action Outcome: 1/25/1994Action Date: Written Plan ReceivedAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 1/24/2003Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 1/24/2003Action Date: Completion Statement ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 1/21/1994Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: C2Response Action Outcome: 1/2/2001Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 1/19/2000Action Date: Modified Revised or Updated Plan ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 1/15/2009Action Date: FLDRUNAction Status: RLFAAction Type: C2Response Action Outcome: 1/13/1995Action Date: Tier 2 ClassificationAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 1/13/1995Action Date: Transmittal, Notice, or Notification ReceivedAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 1/13/1995Action Date: Completion Statement ReceivedAction Status: Phase 1Action Type: C2Response Action Outcome: 1/10/1994Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 19 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 10/4/2002Action Date: Level I - Technical Screen AuditAction Status: Phase 4Action Type: C2Response Action Outcome: 10/31/2001Action Date: Written Plan ReceivedAction Status: Phase 4Action Type: C2Response Action Outcome: 10/31/2001Action Date: Completion Statement ReceivedAction Status: Phase 3Action Type: C2Response Action Outcome: 10/21/1998Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 10/19/2000Action Date: FOLOFFAction Status: RLFAAction Type: C2Response Action Outcome: 10/14/1997Action Date: Written Plan ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 1/31/2014Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 1/31/2014Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 1/31/2008Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 1/31/2008Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 1/27/2003Action Date: Remedy Operation Status Submittal ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 1/25/1994Action Date: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 20 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 2/1/2006Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 12/3/1999Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 12/1/2008Action Date: FOLOFFAction Status: RLFAAction Type: C2Response Action Outcome: 11/9/1995Action Date: Completion Statement ReceivedAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 11/9/1995Action Date: Written Plan ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 11/29/1994Action Date: Status or Interim Report ReceivedAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 11/26/2001Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 11/21/2008Action Date: Written Plan ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 11/1/2010Action Date: Level I - Technical Screen AuditAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 11/1/2002Action Date: NAFNVDAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 11/1/2002Action Date: Level II - Audit InspectionAction Status: Phase 4Action Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 21 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 2/4/2010Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 2/4/2010Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2011Action Date: Inspection and Monitoring Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2011Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2009Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2009Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2005Action Date: Inspection and Monitoring Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2004Action Date: Remedy Operation Status Submittal ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/29/2000Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 2/2/2012Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 2/2/2012Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 2/17/1999Action Date: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 22 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Level II - Audit InspectionAction Status: Phase 5Action Type: C2Response Action Outcome: 4/26/2001Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 4/21/2006Action Date: FLDRUNAction Status: RLFAAction Type: C2Response Action Outcome: 4/2/2010Action Date: FLDRUNAction Status: RLFAAction Type: C2Response Action Outcome: 3/30/2009Action Date: RMRFINAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 3/30/2009Action Date: Completion Statement ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 3/20/1998Action Date: Completion Statement ReceivedAction Status: Phase 2Action Type: C2Response Action Outcome: 3/11/1998Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 2/7/2007Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/7/2007Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 2/4/2013Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 2/4/2013Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 23 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 6/7/2002Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 6/26/2013Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 6/26/2012Action Date: NAFNVDAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 6/26/2012Action Date: Level III - Comprehensive AuditAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 6/23/2010Action Date: FOLOFFAction Status: RLFAAction Type: C2Response Action Outcome: 6/20/2012Action Date: FLDRANAction Status: RLFAAction Type: C2Response Action Outcome: 6/19/2012Action Date: NOAAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 6/19/1998Action Date: Notice of Non-Compliance IssuedAction Status: Compliance and Enforcement ActionAction Type: C2Response Action Outcome: 5/25/1994Action Date: Status or Interim Report ReceivedAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 4/28/1994Action Date: Written Approval of PlanAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 4/27/2006Action Date: NAFNVDAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 4/27/2006Action Date: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 24 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation As-Built Construction Report ReceivedAction Status: Phase 4Action Type: C2Response Action Outcome: 8/12/2005Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/1/2013Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/1/2013Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/1/2006Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 7/28/2011Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 7/28/2011Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 7/25/2008Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 7/25/2008Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 7/19/2013Action Date: Interim Deadline Letter IssuedAction Status: Compliance and Enforcement ActionAction Type: C2Response Action Outcome: 7/16/2012Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 7/12/2011Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 25 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 8/3/2012Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/3/2012Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/3/2007Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/3/2007Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 8/27/1999Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 8/25/2010Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 8/19/2010Action Date: Level II - Audit InspectionAction Status: Phase 5Action Type: C2Response Action Outcome: 8/19/2010Action Date: FOLOFFAction Status: RLFAAction Type: C2Response Action Outcome: 8/19/2010Action Date: NAFNVDAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 8/18/2000Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 8/14/2002Action Date: Completion Statement ReceivedAction Status: Phase 4Action Type: C2Response Action Outcome: 8/14/2002Action Date: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 26 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation PHASE VPhase: Not reportedAssociated ID: 72 HRCategory: 01/10/1994Notification Date: NORTHAMPTONRelease Town: USTSource Type: 08/04/2010Status Date: 1-0010164 / RAORelease Tracking Number/Current Status: Facility: LUST: C2Response Action Outcome: 9/2/2003Action Date: Remedy Operation Status Submittal ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/7/1998Action Date: Written Plan ReceivedAction Status: Phase 4Action Type: C2Response Action Outcome: 8/7/1998Action Date: Completion Statement ReceivedAction Status: Phase 3Action Type: C2Response Action Outcome: 8/6/2004Action Date: Inspection and Monitoring Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/4/2010Action Date: Action Status or AUL TerminatedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/4/2010Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 8/4/2010Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/4/2009Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 8/4/2009Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 27 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation A Notice sent to a Potentially Responsible Party (PRP)Action Type: C2Response Action Outcome: 1/2/2001Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 1/19/2000Action Date: Modified Revised or Updated Plan ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 1/15/2009Action Date: FLDRUNAction Status: RLFAAction Type: C2Response Action Outcome: 1/13/1995Action Date: Tier 2 ClassificationAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 1/13/1995Action Date: Transmittal, Notice, or Notification ReceivedAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 1/13/1995Action Date: Completion Statement ReceivedAction Status: Phase 1Action Type: C2Response Action Outcome: 1/10/1994Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: C2Response Action Outcome: 1/10/1994Action Date: Oral Approval of Plan or ActionAction Status: Immediate Response ActionAction Type: Actions: Not reportedQuantity: GASOLINEChemical: Chemicals: Click here to access the MA DEP site for this facility: USTSource: UNKNOWNSource: COMMERCIALLocation Type: OilOil Or Haz Material: C2 - C2Response Action Outcome: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 28 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 10/19/2000Action Date: FOLOFFAction Status: RLFAAction Type: C2Response Action Outcome: 10/14/1997Action Date: Written Plan ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 1/31/2014Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 1/31/2014Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 1/31/2008Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 1/31/2008Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 1/27/2003Action Date: Remedy Operation Status Submittal ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 1/25/1994Action Date: Reportable Release under MGL 21EAction Status: RNFAction Type: C2Response Action Outcome: 1/25/1994Action Date: Written Plan ReceivedAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 1/24/2003Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 1/24/2003Action Date: Completion Statement ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 1/21/1994Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 29 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 11/9/1995Action Date: Written Plan ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 11/29/1994Action Date: Status or Interim Report ReceivedAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 11/26/2001Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 11/21/2008Action Date: Written Plan ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 11/1/2010Action Date: Level I - Technical Screen AuditAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 11/1/2002Action Date: NAFNVDAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 11/1/2002Action Date: Level II - Audit InspectionAction Status: Phase 4Action Type: C2Response Action Outcome: 10/4/2002Action Date: Level I - Technical Screen AuditAction Status: Phase 4Action Type: C2Response Action Outcome: 10/31/2001Action Date: Written Plan ReceivedAction Status: Phase 4Action Type: C2Response Action Outcome: 10/31/2001Action Date: Completion Statement ReceivedAction Status: Phase 3Action Type: C2Response Action Outcome: 10/21/1998Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 30 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2009Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2005Action Date: Inspection and Monitoring Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2004Action Date: Remedy Operation Status Submittal ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/29/2000Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 2/2/2012Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 2/2/2012Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 2/17/1999Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 2/1/2006Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 12/3/1999Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 12/1/2008Action Date: FOLOFFAction Status: RLFAAction Type: C2Response Action Outcome: 11/9/1995Action Date: Completion Statement ReceivedAction Status: Immediate Response ActionAction Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 31 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 3/30/2009Action Date: Completion Statement ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 3/20/1998Action Date: Completion Statement ReceivedAction Status: Phase 2Action Type: C2Response Action Outcome: 3/11/1998Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 2/7/2007Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/7/2007Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 2/4/2013Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 2/4/2013Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 2/4/2010Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 2/4/2010Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2011Action Date: Inspection and Monitoring Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2011Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 2/3/2009Action Date: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 32 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation FOLOFFAction Status: RLFAAction Type: C2Response Action Outcome: 6/20/2012Action Date: FLDRANAction Status: RLFAAction Type: C2Response Action Outcome: 6/19/2012Action Date: NOAAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 6/19/1998Action Date: Notice of Non-Compliance IssuedAction Status: Compliance and Enforcement ActionAction Type: C2Response Action Outcome: 5/25/1994Action Date: Status or Interim Report ReceivedAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 4/28/1994Action Date: Written Approval of PlanAction Status: Immediate Response ActionAction Type: C2Response Action Outcome: 4/27/2006Action Date: NAFNVDAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 4/27/2006Action Date: Level II - Audit InspectionAction Status: Phase 5Action Type: C2Response Action Outcome: 4/26/2001Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 4/21/2006Action Date: FLDRUNAction Status: RLFAAction Type: C2Response Action Outcome: 4/2/2010Action Date: FLDRUNAction Status: RLFAAction Type: C2Response Action Outcome: 3/30/2009Action Date: RMRFINAction Status: Release Abatement MeasureAction Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 33 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 7/28/2011Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 7/28/2011Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 7/25/2008Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 7/25/2008Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 7/19/2013Action Date: Interim Deadline Letter IssuedAction Status: Compliance and Enforcement ActionAction Type: C2Response Action Outcome: 7/16/2012Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 7/12/2011Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 6/7/2002Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 6/26/2013Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 6/26/2012Action Date: NAFNVDAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 6/26/2012Action Date: Level III - Comprehensive AuditAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 6/23/2010Action Date: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 34 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 8/25/2010Action Date: Tier 2 ExtensionAction Status: Tier ClassificationAction Type: C2Response Action Outcome: 8/19/2010Action Date: Level II - Audit InspectionAction Status: Phase 5Action Type: C2Response Action Outcome: 8/19/2010Action Date: FOLOFFAction Status: RLFAAction Type: C2Response Action Outcome: 8/19/2010Action Date: NAFNVDAction Status: An activity type that is related to an AuditAction Type: C2Response Action Outcome: 8/18/2000Action Date: Status or Interim Report ReceivedAction Status: Release Abatement MeasureAction Type: C2Response Action Outcome: 8/14/2002Action Date: Completion Statement ReceivedAction Status: Phase 4Action Type: C2Response Action Outcome: 8/14/2002Action Date: As-Built Construction Report ReceivedAction Status: Phase 4Action Type: C2Response Action Outcome: 8/12/2005Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/1/2013Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/1/2013Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/1/2006Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 35 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation C2Response Action Outcome: 8/7/1998Action Date: Completion Statement ReceivedAction Status: Phase 3Action Type: C2Response Action Outcome: 8/6/2004Action Date: Inspection and Monitoring Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/4/2010Action Date: Action Status or AUL TerminatedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/4/2010Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 8/4/2010Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/4/2009Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 8/4/2009Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/3/2012Action Date: Inspection and Monitoring Report ReceivedAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/3/2012Action Date: RMRINTAction Status: Response Action Outcome - RAOAction Type: C2Response Action Outcome: 8/3/2007Action Date: Remedy Operation Status Report ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/3/2007Action Date: RMRINTAction Status: Phase 5Action Type: C2Response Action Outcome: 8/27/1999Action Date: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 36 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Not reportedResponse Action Outcome: 7/23/1993Action Date: REMSITAction Status: TREGSAction Type: Not reportedResponse Action Outcome: 6/4/1987Action Date: Valid Transition SiteAction Status: Release DispositionAction Type: Not reportedResponse Action Outcome: 6/4/1987Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: Not reportedResponse Action Outcome: 11/20/1987Action Date: DEPNFAAction Status: TREGSAction Type: Actions: Not reportedQuantity: VOCSChemical: Chemicals: Click here to access the MA DEP site for this facility: USTSource: GASSTATIONLocation Type: OilOil Or Haz Material: -Response Action Outcome: Not reportedPhase: Not reportedAssociated ID: NONECategory: 06/04/1987Notification Date: NORTHAMPTONRelease Town: USTSource Type: 11/20/1987Status Date: 1-0000131 / DEPNFARelease Tracking Number/Current Status: Facility: C2Response Action Outcome: 9/2/2003Action Date: Remedy Operation Status Submittal ReceivedAction Status: Phase 5Action Type: C2Response Action Outcome: 8/7/1998Action Date: Written Plan ReceivedAction Status: Phase 4Action Type: GASOLINE STATION (Continued)S105198660 TC4008590.2s Page 37 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Click here to access the MA DEP site for this facility: Hazardous MaterialOil / Haz Material Type: Significant Risk exists. B1 - Remedial actions have not been conducted because a level of NoResponse Action Outcome: Not reportedPhase: 04/16/2010Status Date: 120 DYCategory: 04/10/2009Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0017408 / RAORelease Tracking Number/Current Status: Click here to access the MA DEP site for this facility: OilOil / Haz Material Type: C2 - C2Response Action Outcome: PHASE VPhase: 08/04/2010Status Date: 72 HRCategory: 01/10/1994Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0010164 / RAORelease Tracking Number/Current Status: Click here to access the MA DEP site for this facility: OilOil / Haz Material Type: -Response Action Outcome: Not reportedPhase: 11/20/1987Status Date: NONECategory: 06/04/1987Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0000131 / DEPNFARelease Tracking Number/Current Status: Release: GASOLINE STATION (Continued)S105198660 -Response Action Outcome: Not reportedPhase: 07/23/1993Status Date: No Further Action (DEP Determined)Current Status: Not reportedAssociated ID: NONECategory: 01/15/1988Notification Date: NORTHAMPTONRelease Town: 1-0000358 / DEPNFARelease Tracking Number/Current Status: SHWS: 3410 ft. 0.646 mi. Relative:Lower Actual:135 ft. 1/2-1 HW GENNORTHAMPTON, MA 01060 ENE RELEASE14 EASTHAMPTON ST N/A 6 SHWSBACON PROPERTY S100829364 TC4008590.2s Page 38 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation VQG-MAState Generator Status: VSQGRCRA Generator Status: MV4135827078EPA Id: HW GEN: Click here to access the MA DEP site for this facility: OilOil / Haz Material Type: -Response Action Outcome: Not reportedPhase: 07/23/1993Status Date: NONECategory: 01/15/1988Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0000358 / DEPNFARelease Tracking Number/Current Status: Release: Not reportedResponse Action Outcome: 7/23/1993Action Date: DEPNFAAction Status: TREGSAction Type: Not reportedResponse Action Outcome: 1/15/1988Action Date: Valid Transition SiteAction Status: Release DispositionAction Type: Actions: Not reportedQuantity: PETROLEUMChemical: Chemicals: Click here to access the MA DEP site for this facility: DRYWELLSource: COMMERCIALLocation Type: OilOil Or Haz Material: BACON PROPERTY (Continued)S100829364 Not reportedPhase: 04/20/1994Status Date: Pending No Further ActionCurrent Status: Not reportedAssociated ID: NONECategory: 01/15/1989Notification Date: NORTHAMPTONRelease Town: 1-0000549 / PENNFARelease Tracking Number/Current Status: SHWS: 3555 ft. 0.673 mi. Relative:Lower Actual:134 ft. 1/2-1 ENFNORTHAMPTON, MA 01060 ENE RELEASEEASTHAMPTON RD N/A 7 SHWSALLEN & SONS INC S100361857 TC4008590.2s Page 39 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Solid WasteProg: Not reportedComments: TRANSFER STATIONSecond Name: NON-WE-00-4004Facility ID: 2000-02-14 00:00:00Issue Date: WEReg: SOUTH HADLEY, MA 01075Address 2: 600 NEW LUDLOW RDAddress 1: COMMERCIAL DISPOSAL COName: NONFacility Type: NON-WE-00-4004Facility ID: MA ENFORCEMENT : Click here to access the MA DEP site for this facility: Not reportedOil / Haz Material Type: -Response Action Outcome: Not reportedPhase: 04/20/1994Status Date: NONECategory: 01/15/1989Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0000549 / PENNFARelease Tracking Number/Current Status: Release: Not reportedResponse Action Outcome: 4/20/1994Action Date: PENNFAAction Status: TREGSAction Type: Not reportedResponse Action Outcome: 1/15/1989Action Date: Valid Transition SiteAction Status: Release DispositionAction Type: Actions: Not reportedQuantity: UNKNOWNChemical: Chemicals: Click here to access the MA DEP site for this facility: Not reportedOil Or Haz Material: -Response Action Outcome: ALLEN & SONS INC (Continued)S100361857 TC4008590.2s Page 40 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/31/2013Action Date: Transmittal, Notice, or Notification ReceivedAction Status: BOLAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/22/2013Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/16/2013Action Date: Oral Approval of Plan or ActionAction Status: Immediate Response ActionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/16/2013Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 1/23/2014Action Date: Level I - Technical Screen AuditAction Status: Response Action Outcome - RAOAction Type: Actions: 205 parts per millionQuantity: #2 FUEL OILChemical: Chemicals: Click here to access the MA DEP site for this facility: USTSource: TANKSource: COMMERCIALLocation Type: OilOil Or Haz Material: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: 12/17/2013Status Date: Response Action OutcomeCurrent Status: Not reportedAssociated ID: 72 HRCategory: 10/16/2013Notification Date: NORTHAMPTONRelease Town: 1-0019243 / RAORelease Tracking Number/Current Status: SHWS: 4489 ft. 0.850 mi. Relative:Lower Actual:141 ft. 1/2-1 RELEASENORTHAMPTON, MA ENE LUST375 SOUTH STREET N/A 8 SHWSN/A S114965420 TC4008590.2s Page 41 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/16/2013Action Date: Oral Approval of Plan or ActionAction Status: Immediate Response ActionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/16/2013Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 1/23/2014Action Date: Level I - Technical Screen AuditAction Status: Response Action Outcome - RAOAction Type: Actions: 205 parts per millionQuantity: #2 FUEL OILChemical: Chemicals: Click here to access the MA DEP site for this facility: USTSource: TANKSource: COMMERCIALLocation Type: OilOil Or Haz Material: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: Not reportedAssociated ID: 72 HRCategory: 10/16/2013Notification Date: NORTHAMPTONRelease Town: USTSource Type: 12/17/2013Status Date: 1-0019243 / RAORelease Tracking Number/Current Status: Facility: LUST: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 12/17/2013Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 12/12/2013Action Date: SHPTMPAction Status: BOLAction Type: N/A (Continued)S114965420 TC4008590.2s Page 42 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation Click here to access the MA DEP site for this facility: OilOil / Haz Material Type: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: 12/17/2013Status Date: 72 HRCategory: 10/16/2013Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0019243 / RAORelease Tracking Number/Current Status: Release: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 12/17/2013Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 12/12/2013Action Date: SHPTMPAction Status: BOLAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/31/2013Action Date: Transmittal, Notice, or Notification ReceivedAction Status: BOLAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/22/2013Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: reduced to background. N/A (Continued)S114965420 Not reportedPhase: 05/17/2007Status Date: Response Action OutcomeCurrent Status: Not reportedAssociated ID: 120 DYCategory: 05/09/2007Notification Date: NORTHAMPTONRelease Town: 1-0016611 / RAORelease Tracking Number/Current Status: SHWS: 4967 ft.HW GEN 0.941 mi.RELEASE Relative:Lower Actual:133 ft. 1/2-1 LASTNORTHAMPTON, MA 01060 ENE LUST25 TEXAS RD N/A 9 SHWSO’CONNELL OIL S108117520 TC4008590.2s Page 43 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation OilOil Or Haz Material: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: Not reportedAssociated ID: 72 HRCategory: 03/30/1995Notification Date: NORTHAMPTONRelease Town: USTSource Type: 11/29/1995Status Date: 1-0010797 / RAORelease Tracking Number/Current Status: Facility: LUST: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 5/9/2007Action Date: Reportable Release under MGL 21EAction Status: RNFAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 5/9/2007Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 5/17/2007Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 5/11/2007Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 11/7/2007Action Date: Level I - Technical Screen AuditAction Status: Response Action Outcome - RAOAction Type: Actions: 280 milligrams per kilogramQuantity: C11 THRU C22 AROMATIC HYDROCARBONSChemical: Chemicals: Click here to access the MA DEP site for this facility: OilOil Or Haz Material: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: O’CONNELL OIL (Continued)S108117520 TC4008590.2s Page 44 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation A Notice sent to a Potentially Responsible Party (PRP)Action Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 3/30/1995Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 3/30/1995Action Date: Oral Approval of Plan or ActionAction Status: Immediate Response ActionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 11/29/1995Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 11/29/1995Action Date: Completion Statement ReceivedAction Status: Immediate Response ActionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 11/27/1995Action Date: Fee Received - FMCRA Use OnlyAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/3/1995Action Date: Notice of Non-Compliance IssuedAction Status: Compliance and Enforcement ActionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/19/1995Action Date: Written Plan ReceivedAction Status: Immediate Response ActionAction Type: Actions: 100 parts per millionQuantity: #2 FUEL OILChemical: 1400 milligrams per kilogramQuantity: TOTAL PETROLEUM HYDROCARBONS (TPH)Chemical: Chemicals: Click here to access the MA DEP site for this facility: USTSource: INDUSTRIALLocation Type: O’CONNELL OIL (Continued)S108117520 TC4008590.2s Page 45 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/13/2006Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: Actions: 77 parts per millionQuantity: #2 FUEL OILChemical: 82 milligrams per literQuantity: C11 THRU C22 AROMATIC HYDROCARBONSChemical: 2040 milligrams per kilogramQuantity: C11 THRU C22 AROMATIC HYDROCARBONSChemical: 83.4 milligrams per literQuantity: C9 THRU C18 ALIPHATIC HYDROCARBONSChemical: 2050 milligrams per kilogramQuantity: C9 THRU C18 ALIPHATIC HYDROCARBONSChemical: Chemicals: Click here to access the MA DEP site for this facility: USTSource: COMMERCIALLocation Type: INDUSTRIALLocation Type: OilOil Or Haz Material: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: Not reportedAssociated ID: 120 DYCategory: 10/13/2006Notification Date: NORTHAMPTONRelease Town: USTSource Type: 02/09/2007Status Date: 1-0016339 / RAORelease Tracking Number/Current Status: Facility: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 7/11/1995Action Date: Status or Interim Report ReceivedAction Status: Immediate Response ActionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 6/19/1995Action Date: Reportable Release under MGL 21EAction Status: RNFAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 4/3/1995Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: O’CONNELL OIL (Continued)S108117520 TC4008590.2s Page 46 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation 12/18/2009Status Date: Not reportedAssociated ID: TWO HRCategory: 08/20/2009Notification Date: NORTHAMPTONRelease Town: ASTSource Type: 1-0017552 / RAORelease Tracking Number/Current Status: LAST: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 9/8/2006Action Date: Release or TOR Less than Reporting RequirementAction Status: Release DispositionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 2/9/2007Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 2/23/2007Action Date: Level I - Technical Screen AuditAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/31/2006Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/20/2006Action Date: Fee Received - FMCRA Use OnlyAction Status: Release Abatement MeasureAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/17/2006Action Date: Level I - Technical Screen AuditAction Status: Release Abatement MeasureAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/13/2006Action Date: Reportable Release under MGL 21EAction Status: RNFAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/13/2006Action Date: Written Plan ReceivedAction Status: Release Abatement MeasureAction Type: O’CONNELL OIL (Continued)S108117520 TC4008590.2s Page 47 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 8/21/2009Action Date: FLDD1UAction Status: RLFAAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 8/20/2009Action Date: Oral Approval of Plan or ActionAction Status: Immediate Response ActionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 8/20/2009Action Date: Reportable Release under MGL 21EAction Status: Release DispositionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 12/21/2009Action Date: Level I - Technical Screen AuditAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 12/18/2009Action Date: RAO Statement ReceivedAction Status: Response Action Outcome - RAOAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/19/2009Action Date: Transmittal, Notice, or Notification ReceivedAction Status: RNFEAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/19/2009Action Date: Written Plan ReceivedAction Status: Immediate Response ActionAction Type: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 10/19/2009Action Date: Imminent Hazard Evaluation ReceivedAction Status: Immediate Response ActionAction Type: Actions: ASTSource: INDUSTRIALLocation Type: 150 gallonsQuantity: #2 FUEL OILChemical: Chemicals: OilOil Or Haz Material: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: O’CONNELL OIL (Continued)S108117520 TC4008590.2s Page 48 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation TWO HRCategory: 08/20/2009Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0017552 / RAORelease Tracking Number/Current Status: Click here to access the MA DEP site for this facility: OilOil / Haz Material Type: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: 05/17/2007Status Date: 120 DYCategory: 05/09/2007Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0016611 / RAORelease Tracking Number/Current Status: Click here to access the MA DEP site for this facility: OilOil / Haz Material Type: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: 02/09/2007Status Date: 120 DYCategory: 10/13/2006Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0016339 / RAORelease Tracking Number/Current Status: Click here to access the MA DEP site for this facility: OilOil / Haz Material Type: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: 11/29/1995Status Date: 72 HRCategory: 03/30/1995Notification: NORTHAMPTONOfficial City: Not reportedPrimary ID: 1-0010797 / RAORelease Tracking Number/Current Status: Release: reduced to background. A permanent solution has been achieved. Contamination has not beenResponse Action Outcome: 8/25/2009Action Date: A MassDEP piece of correspondence was issued (approvals, NORs, etc.Action Status: A Notice sent to a Potentially Responsible Party (PRP)Action Type: reduced to background. O’CONNELL OIL (Continued)S108117520 TC4008590.2s Page 49 MAP FINDINGSMap ID Direction EDR ID NumberDistance EPA ID NumberDatabase(s)SiteElevation SQG-MAState Generator Status: VSQGRCRA Generator Status: MAD982200263EPA Id: HW GEN: Click here to access the MA DEP site for this facility: OilOil / Haz Material Type: been reduced to background. A2 - A permanent solution has been achieved. Contamination has notResponse Action Outcome: Not reportedPhase: 12/18/2009Status Date: O’CONNELL OIL (Continued)S108117520 TC4008590.2s Page 50 OR P H A N S U M M A R Y Cit y E D R I D S i t e N a m e S i t e A d d r e s s Z i p D a t a b a s e ( s ) Co u n t : 2 0 r e c o r d s . EA S T H A M P T O N S 1 0 6 9 5 3 8 0 9 N O L O C A T I O N A I D R T E 1 4 1 01 0 2 7 S H W S , R E L E A S E EA S T H A M P T O N S 1 0 4 9 4 1 7 0 2 O X B O W S T A T E B O A T R A M P R O U T E 5 0 1 0 2 7 S H W S , R E L EA S E EA S T H A M P T O N S 1 0 2 6 1 8 1 5 6 N O L O C A T I O N A I D F O R T H I L L R D 0 1 0 2 7 S H W S , R E L E AS E EA S T H A M P T O N S 1 0 6 6 1 7 2 9 7 L O W E R M I L L P O N D O F F M E C H A N I C S T 0 1 0 2 7 S H W S , R EL E A S E EA S T H A M P T O N S 1 0 2 4 0 3 5 7 0 T T U A C C I D E N T P A R K S T 01 0 2 7 S H W S , R E L E A S E EA S T H A M P T O N S 1 0 6 7 7 5 6 3 1 P O L E 1 8 8 / 4 4 W E S T S T N E A R G L E N D A L E 0 1 0 2 7 S H W S , R E L E A S E NO R T H A M P T O N S 1 0 9 1 4 6 5 0 4 N O R T H O F E X I T 1 8 R T E 9 1 N O R T H B O U N D 0 1 0 6 0 S H W S , R E L E A S E NO R T H A M P T O N S 1 0 6 5 1 0 0 9 2 M M 2 1 R T E 9 1 SH W S , R E L E A S E NO R T H A M P T O N S 1 0 6 1 3 2 1 4 9 B R I D G E O V E R O X B O W R T E 9 1 S O U T H B O U N D S H W S , R E LE A S E NO R T H A M P T O N S 1 0 4 5 6 2 2 9 9 P O L E # 1 C O O K A V E SH W S , R E L E A S E NO R T H A M P T O N S 1 0 2 0 8 3 5 8 7 M M 2 3 . 5 R T I - 9 1 N SH W S , R E L E A S E NO R T H A M P T O N S 1 0 7 4 0 5 7 1 7 M U L T I F A M I L Y R E S I D E N C E 1 2 M O N R O E S T LU S T , R E L E A S E NO R T H A M P T O N S 1 0 4 7 7 4 0 3 0 M I L E 2 3 . 3 I - 9 1 N O R T H B O U N D S H W S , R E L E A S E NO R T H A M P T O N S 1 0 5 5 9 6 2 3 3 P O L E 4 - 0 3 P I N E S T R E E T E X T S H W S , R E L E A S E NO R T H A M P T O N S 1 0 4 5 6 2 3 0 0 P O L E # 7 P I N E B R O O K C U R V S H W S , R E L E A S E NO R T H A M P T O N S 1 0 7 4 0 4 8 3 4 N O R T H A M P T O N S T A T E H O S P I T A L D U M P P R I N C E S T 0 1 06 0 S W F / L F NO R T H A M P T O N 1 0 0 9 4 3 2 9 9 8 R Y A N R O A D E L E M E N T A R Y R Y A N R D FI N D S NO R T H A M P T O N S 1 0 2 0 8 3 0 7 0 M A H I G H W A Y # 2 0 M T T O M R D SH W S , R E L E A S E WE S T H A M P T O N 1 0 0 6 8 3 5 0 4 0 W E S T H A M P T O N L A N D F I L L H A T H A W A Y R D FI N D S , S W F / L F , E N F WE S T H A M P T O N S 1 0 5 7 3 5 4 9 6 P O L E # 1 8 5 8 M A I N R D 01 0 2 7 S H W S , R E L E A S E TC 4 0 0 8 5 9 0 . 2 s P a g e 5 1 To maintain currency of the following federal and state databases, EDR contacts the appropriate governmental agency on a monthly or quarterly basis, as required. Number of Days to Update:Provides confirmation that EDR is reporting records that have been updated within 90 days from the date the government agency made the information available to the public. STANDARD ENVIRONMENTAL RECORDS Federal NPL site list NPL: National Priority List National Priorities List (Superfund). The NPL is a subset of CERCLIS and identifies over 1,200 sites for priority cleanup under the Superfund Program. NPL sites may encompass relatively large areas. As such, EDR provides polygon coverage for over 1,000 NPL site boundaries produced by EPA’s Environmental Photographic Interpretation Center (EPIC) and regional EPA offices. Date of Government Version: 10/25/2013 Date Data Arrived at EDR: 11/11/2013 Date Made Active in Reports: 01/28/2014 Number of Days to Update: 78 Source: EPA Telephone: N/A Last EDR Contact: 07/08/2014 Next Scheduled EDR Contact: 10/20/2014 Data Release Frequency: Quarterly NPL Site Boundaries Sources: EPA’s Environmental Photographic Interpretation Center (EPIC) Telephone: 202-564-7333 EPA Region 1EPA Region 6 Telephone 617-918-1143Telephone: 214-655-6659 EPA Region 3EPA Region 7 Telephone 215-814-5418Telephone: 913-551-7247 EPA Region 4EPA Region 8 Telephone 404-562-8033Telephone: 303-312-6774 EPA Region 5EPA Region 9 Telephone 312-886-6686Telephone: 415-947-4246 EPA Region 10 Telephone 206-553-8665 Proposed NPL: Proposed National Priority List Sites A site that has been proposed for listing on the NationalPriorities List through the issuance of a proposed rule in the Federal Register.EPA then accepts public comments on the site, responds to the comments,and places on the NPL those sites that continue to meet therequirements for listing. Date of Government Version: 10/25/2013 Date Data Arrived at EDR: 11/11/2013 Date Made Active in Reports: 01/28/2014 Number of Days to Update: 78 Source: EPA Telephone: N/A Last EDR Contact: 07/08/2014 Next Scheduled EDR Contact: 10/20/2014 Data Release Frequency: Quarterly NPL LIENS: Federal Superfund Liens Federal Superfund Liens. Under the authority granted the USEPA by CERCLA of 1980, the USEPA has the authority to file liens against real property in order to recover remedial action expenditures or when the property owner received notification of potential liability. USEPA compiles a listing of filed notices of Superfund Liens. Date of Government Version: 10/15/1991 Date Data Arrived at EDR: 02/02/1994 Date Made Active in Reports: 03/30/1994 Number of Days to Update: 56 Source: EPA Telephone: 202-564-4267 Last EDR Contact: 08/15/2011 Next Scheduled EDR Contact: 11/28/2011 Data Release Frequency: No Update Planned TC4008590.2s Page GR-1 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Federal Delisted NPL site list DELISTED NPL: National Priority List Deletions The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) establishes the criteria that the EPA uses to delete sites from the NPL. In accordance with 40 CFR 300.425.(e), sites may be deleted from the NPL where no further response is appropriate. Date of Government Version: 10/25/2013 Date Data Arrived at EDR: 11/11/2013 Date Made Active in Reports: 01/28/2014 Number of Days to Update: 78 Source: EPA Telephone: N/A Last EDR Contact: 07/08/2014 Next Scheduled EDR Contact: 10/20/2014 Data Release Frequency: Quarterly Federal CERCLIS list CERCLIS: Comprehensive Environmental Response, Compensation, and Liability Information System CERCLIS contains data on potentially hazardous waste sites that have been reported to the USEPA by states, municipalities, private companies and private persons, pursuant to Section 103 of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA). CERCLIS contains sites which are either proposed to or on the National Priorities List (NPL) and sites which are in the screening and assessment phase for possible inclusion on the NPL. Date of Government Version: 10/25/2013 Date Data Arrived at EDR: 11/11/2013 Date Made Active in Reports: 02/13/2014 Number of Days to Update: 94 Source: EPA Telephone: 703-412-9810 Last EDR Contact: 05/29/2014 Next Scheduled EDR Contact: 09/08/2014 Data Release Frequency: Quarterly FEDERAL FACILITY: Federal Facility Site Information listing A listing of National Priority List (NPL) and Base Realignment and Closure (BRAC) sites found in the Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) Database where EPA Federal Facilities Restoration and Reuse Office is involved in cleanup activities. Date of Government Version: 05/31/2013 Date Data Arrived at EDR: 07/08/2013 Date Made Active in Reports: 12/06/2013 Number of Days to Update: 151 Source: Environmental Protection Agency Telephone: 703-603-8704 Last EDR Contact: 07/08/2014 Next Scheduled EDR Contact: 10/20/2014 Data Release Frequency: Varies Federal CERCLIS NFRAP site List CERCLIS-NFRAP: CERCLIS No Further Remedial Action Planned Archived sites are sites that have been removed and archived from the inventory of CERCLIS sites. Archived status indicates that, to the best of EPA’s knowledge, assessment at a site has been completed and that EPA has determined no further steps will be taken to list this site on the National Priorities List (NPL), unless information indicates this decision was not appropriate or other considerations require a recommendation for listing at a later time. This decision does not necessarily mean that there is no hazard associated with a given site; it only means that, based upon available information, the location is not judged to be a potential NPL site. Date of Government Version: 10/25/2013 Date Data Arrived at EDR: 11/11/2013 Date Made Active in Reports: 02/13/2014 Number of Days to Update: 94 Source: EPA Telephone: 703-412-9810 Last EDR Contact: 05/29/2014 Next Scheduled EDR Contact: 09/08/2014 Data Release Frequency: Quarterly Federal RCRA CORRACTS facilities list CORRACTS: Corrective Action Report CORRACTS identifies hazardous waste handlers with RCRA corrective action activity. TC4008590.2s Page GR-2 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 03/11/2014 Date Data Arrived at EDR: 03/13/2014 Date Made Active in Reports: 04/09/2014 Number of Days to Update: 27 Source: EPA Telephone: 800-424-9346 Last EDR Contact: 07/02/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Quarterly Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDF: RCRA - Treatment, Storage and Disposal RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Transporters are individuals or entities that move hazardous waste from the generator offsite to a facility that can recycle, treat, store, or dispose of the waste. TSDFs treat, store, or dispose of the waste. Date of Government Version: 03/11/2014 Date Data Arrived at EDR: 03/13/2014 Date Made Active in Reports: 04/09/2014 Number of Days to Update: 27 Source: Environmental Protection Agency Telephone: (888) 372-7341 Last EDR Contact: 07/02/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Quarterly Federal RCRA generators list RCRA-LQG: RCRA - Large Quantity Generators RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Large quantity generators (LQGs) generate over 1,000 kilograms (kg) of hazardous waste, or over 1 kg of acutely hazardous waste per month. Date of Government Version: 03/11/2014 Date Data Arrived at EDR: 03/13/2014 Date Made Active in Reports: 04/09/2014 Number of Days to Update: 27 Source: Environmental Protection Agency Telephone: (888) 372-7341 Last EDR Contact: 07/02/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Quarterly RCRA-SQG: RCRA - Small Quantity Generators RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Small quantity generators (SQGs) generate between 100 kg and 1,000 kg of hazardous waste per month. Date of Government Version: 03/11/2014 Date Data Arrived at EDR: 03/13/2014 Date Made Active in Reports: 04/09/2014 Number of Days to Update: 27 Source: Environmental Protection Agency Telephone: (888) 372-7341 Last EDR Contact: 07/02/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Quarterly RCRA-CESQG: RCRA - Conditionally Exempt Small Quantity Generators RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Conditionally exempt small quantity generators (CESQGs) generate less than 100 kg of hazardous waste, or less than 1 kg of acutely hazardous waste per month. Date of Government Version: 03/11/2014 Date Data Arrived at EDR: 03/13/2014 Date Made Active in Reports: 04/09/2014 Number of Days to Update: 27 Source: Environmental Protection Agency Telephone: (888) 372-7341 Last EDR Contact: 07/02/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Varies TC4008590.2s Page GR-3 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Federal institutional controls / engineering controls registries US ENG CONTROLS: Engineering Controls Sites List A listing of sites with engineering controls in place. Engineering controls include various forms of caps, building foundations, liners, and treatment methods to create pathway elimination for regulated substances to enter environmental media or effect human health. Date of Government Version: 03/19/2014 Date Data Arrived at EDR: 03/21/2014 Date Made Active in Reports: 07/15/2014 Number of Days to Update: 116 Source: Environmental Protection Agency Telephone: 703-603-0695 Last EDR Contact: 06/05/2014 Next Scheduled EDR Contact: 09/22/2014 Data Release Frequency: Varies US INST CONTROL: Sites with Institutional Controls A listing of sites with institutional controls in place. Institutional controls include administrative measures, such as groundwater use restrictions, construction restrictions, property use restrictions, and post remediation care requirements intended to prevent exposure to contaminants remaining on site. Deed restrictions are generally required as part of the institutional controls. Date of Government Version: 03/19/2014 Date Data Arrived at EDR: 03/21/2014 Date Made Active in Reports: 07/15/2014 Number of Days to Update: 116 Source: Environmental Protection Agency Telephone: 703-603-0695 Last EDR Contact: 06/05/2014 Next Scheduled EDR Contact: 09/22/2014 Data Release Frequency: Varies LUCIS: Land Use Control Information System LUCIS contains records of land use control information pertaining to the former Navy Base Realignment and Closure properties. Date of Government Version: 05/28/2014 Date Data Arrived at EDR: 05/30/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 18 Source: Department of the Navy Telephone: 843-820-7326 Last EDR Contact: 05/19/2014 Next Scheduled EDR Contact: 09/01/2014 Data Release Frequency: Varies Federal ERNS list ERNS: Emergency Response Notification System Emergency Response Notification System. ERNS records and stores information on reported releases of oil and hazardous substances. Date of Government Version: 09/30/2013 Date Data Arrived at EDR: 10/01/2013 Date Made Active in Reports: 12/06/2013 Number of Days to Update: 66 Source: National Response Center, United States Coast Guard Telephone: 202-267-2180 Last EDR Contact: 07/03/2014 Next Scheduled EDR Contact: 07/14/2014 Data Release Frequency: Annually State- and tribal - equivalent CERCLIS SHWS: Site Transition List Contains information on releases of oil and hazardous materials that have been reported to DEP. Date of Government Version: 04/11/2014 Date Data Arrived at EDR: 04/15/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 23 Source: Department of Environmental Protection Telephone: 617-292-5990 Last EDR Contact: 07/15/2014 Next Scheduled EDR Contact: 10/27/2014 Data Release Frequency: Quarterly State and tribal landfill and/or solid waste disposal site lists TC4008590.2s Page GR-4 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING SWF/LF: Solid Waste Facility Database/Transfer Stations Solid Waste Facilities/Landfill Sites. SWF/LF type records typically contain an inventory of solid waste disposal facilities or landfills in a particular state. Depending on the state, these may be active or inactive facilities or open dumps that failed to meet RCRA Subtitle D Section 4004 criteria for solid waste landfills or disposal sites. Date of Government Version: 02/27/2014 Date Data Arrived at EDR: 04/09/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 29 Source: Department of Environmental Protection Telephone: 617-292-5989 Last EDR Contact: 07/11/2014 Next Scheduled EDR Contact: 10/20/2014 Data Release Frequency: Quarterly State and tribal leaking storage tank lists LUST: Leaking Underground Storage Tank Listing Sites within the Leaking Underground Storage Tank Listing that have a UST listed as its source. Date of Government Version: 04/11/2014 Date Data Arrived at EDR: 04/15/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 23 Source: Department of Environmental Protection Telephone: 617-292-5990 Last EDR Contact: 07/15/2014 Next Scheduled EDR Contact: 10/27/2014 Data Release Frequency: Quarterly LAST: Leaking Aboveground Storage Tank Sites Sites within the Releases Database that have a AST listed as its source. Date of Government Version: 04/11/2014 Date Data Arrived at EDR: 04/15/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 23 Source: Department of Environmental Protection Telephone: 617-292-5500 Last EDR Contact: 07/15/2014 Next Scheduled EDR Contact: 10/27/2014 Data Release Frequency: Quarterly INDIAN LUST R9: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Arizona, California, New Mexico and Nevada Date of Government Version: 03/01/2013 Date Data Arrived at EDR: 03/01/2013 Date Made Active in Reports: 04/12/2013 Number of Days to Update: 42 Source: Environmental Protection Agency Telephone: 415-972-3372 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Quarterly INDIAN LUST R10: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Alaska, Idaho, Oregon and Washington. Date of Government Version: 11/06/2013 Date Data Arrived at EDR: 11/07/2013 Date Made Active in Reports: 12/06/2013 Number of Days to Update: 29 Source: EPA Region 10 Telephone: 206-553-2857 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Quarterly INDIAN LUST R4: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Florida, Mississippi and North Carolina. Date of Government Version: 04/24/2014 Date Data Arrived at EDR: 04/25/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 53 Source: EPA Region 4 Telephone: 404-562-8677 Last EDR Contact: 04/22/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Semi-Annually TC4008590.2s Page GR-5 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING INDIAN LUST R6: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in New Mexico and Oklahoma. Date of Government Version: 05/14/2014 Date Data Arrived at EDR: 05/15/2014 Date Made Active in Reports: 07/15/2014 Number of Days to Update: 61 Source: EPA Region 6 Telephone: 214-665-6597 Last EDR Contact: 02/21/2014 Next Scheduled EDR Contact: 05/12/2014 Data Release Frequency: Varies INDIAN LUST R7: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Iowa, Kansas, and Nebraska Date of Government Version: 04/28/2014 Date Data Arrived at EDR: 05/01/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 47 Source: EPA Region 7 Telephone: 913-551-7003 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies INDIAN LUST R8: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Colorado, Montana, North Dakota, South Dakota, Utah and Wyoming. Date of Government Version: 08/27/2012 Date Data Arrived at EDR: 08/28/2012 Date Made Active in Reports: 10/16/2012 Number of Days to Update: 49 Source: EPA Region 8 Telephone: 303-312-6271 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Quarterly INDIAN LUST R5: Leaking Underground Storage Tanks on Indian Land Leaking underground storage tanks located on Indian Land in Michigan, Minnesota and Wisconsin. Date of Government Version: 05/12/2014 Date Data Arrived at EDR: 05/12/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 36 Source: EPA, Region 5 Telephone: 312-886-7439 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies INDIAN LUST R1: Leaking Underground Storage Tanks on Indian Land A listing of leaking underground storage tank locations on Indian Land. Date of Government Version: 02/01/2013 Date Data Arrived at EDR: 05/01/2013 Date Made Active in Reports: 11/01/2013 Number of Days to Update: 184 Source: EPA Region 1 Telephone: 617-918-1313 Last EDR Contact: 05/02/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies State and tribal registered storage tank lists UST: Summary Listing of all the Tanks Registered in the State of Massachusetts Registered Underground Storage Tanks. UST’s are regulated under Subtitle I of the Resource Conservation and Recovery Act (RCRA) and must be registered with the state department responsible for administering the UST program. Available information varies by state program. Date of Government Version: 04/18/2014 Date Data Arrived at EDR: 04/22/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 16 Source: Department of Fire Services, Office of the Public Safety Telephone: 617-556-1035 Last EDR Contact: 04/22/2014 Next Scheduled EDR Contact: 08/04/2014 Data Release Frequency: Quarterly AST: Aboveground Storage Tank Database Registered Aboveground Storage Tanks. TC4008590.2s Page GR-6 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 10/22/2009 Date Data Arrived at EDR: 10/28/2009 Date Made Active in Reports: 11/06/2009 Number of Days to Update: 9 Source: Department of Public Safety Telephone: 617-556-1035 Last EDR Contact: 04/21/2014 Next Scheduled EDR Contact: 08/04/2014 Data Release Frequency: Quarterly INDIAN UST R7: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 7 (Iowa, Kansas, Missouri, Nebraska, and 9 Tribal Nations). Date of Government Version: 05/28/2014 Date Data Arrived at EDR: 05/01/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 47 Source: EPA Region 7 Telephone: 913-551-7003 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies INDIAN UST R10: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 10 (Alaska, Idaho, Oregon, Washington, and Tribal Nations). Date of Government Version: 04/04/2014 Date Data Arrived at EDR: 04/08/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 70 Source: EPA Region 10 Telephone: 206-553-2857 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Quarterly INDIAN UST R9: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 9 (Arizona, California, Hawaii, Nevada, the Pacific Islands, and Tribal Nations). Date of Government Version: 05/12/2014 Date Data Arrived at EDR: 05/14/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 34 Source: EPA Region 9 Telephone: 415-972-3368 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Quarterly INDIAN UST R8: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 8 (Colorado, Montana, North Dakota, South Dakota, Utah, Wyoming and 27 Tribal Nations). Date of Government Version: 05/07/2014 Date Data Arrived at EDR: 05/09/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 39 Source: EPA Region 8 Telephone: 303-312-6137 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Quarterly INDIAN UST R6: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 6 (Louisiana, Arkansas, Oklahoma, New Mexico, Texas and 65 Tribes). Date of Government Version: 05/14/2014 Date Data Arrived at EDR: 05/15/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 33 Source: EPA Region 6 Telephone: 214-665-7591 Last EDR Contact: 01/27/2014 Next Scheduled EDR Contact: 05/12/2014 Data Release Frequency: Semi-Annually INDIAN UST R5: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 5 (Michigan, Minnesota and Wisconsin and Tribal Nations). TC4008590.2s Page GR-7 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 05/12/2014 Date Data Arrived at EDR: 05/12/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 36 Source: EPA Region 5 Telephone: 312-886-6136 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies INDIAN UST R4: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 4 (Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee and Tribal Nations) Date of Government Version: 04/24/2014 Date Data Arrived at EDR: 04/25/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 53 Source: EPA Region 4 Telephone: 404-562-9424 Last EDR Contact: 04/22/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Semi-Annually INDIAN UST R1: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 1 (Connecticut, Maine, Massachusetts, New Hampshire, Rhode Island, Vermont and ten Tribal Nations). Date of Government Version: 02/01/2013 Date Data Arrived at EDR: 05/01/2013 Date Made Active in Reports: 01/27/2014 Number of Days to Update: 271 Source: EPA, Region 1 Telephone: 617-918-1313 Last EDR Contact: 05/02/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies FEMA UST: Underground Storage Tank Listing A listing of all FEMA owned underground storage tanks. Date of Government Version: 01/01/2010 Date Data Arrived at EDR: 02/16/2010 Date Made Active in Reports: 04/12/2010 Number of Days to Update: 55 Source: FEMA Telephone: 202-646-5797 Last EDR Contact: 07/08/2014 Next Scheduled EDR Contact: 10/27/2014 Data Release Frequency: Varies State and tribal institutional control / engineering control registries INST CONTROL: Sites With Activity and Use Limitation Activity and Use Limitations establish limits and conditions on the future use of contaminated property, and therefore allow cleanups to be tailored to these uses. Date of Government Version: 04/11/2014 Date Data Arrived at EDR: 04/08/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 30 Source: Department of Environmental Protection Telephone: 617-292-5990 Last EDR Contact: 07/15/2014 Next Scheduled EDR Contact: 10/27/2014 Data Release Frequency: Quarterly State and tribal voluntary cleanup sites INDIAN VCP R7: Voluntary Cleanup Priority Lisitng A listing of voluntary cleanup priority sites located on Indian Land located in Region 7. Date of Government Version: 03/20/2008 Date Data Arrived at EDR: 04/22/2008 Date Made Active in Reports: 05/19/2008 Number of Days to Update: 27 Source: EPA, Region 7 Telephone: 913-551-7365 Last EDR Contact: 04/20/2009 Next Scheduled EDR Contact: 07/20/2009 Data Release Frequency: Varies TC4008590.2s Page GR-8 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING INDIAN VCP R1: Voluntary Cleanup Priority Listing A listing of voluntary cleanup priority sites located on Indian Land located in Region 1. Date of Government Version: 03/20/2014 Date Data Arrived at EDR: 04/01/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 77 Source: EPA, Region 1 Telephone: 617-918-1102 Last EDR Contact: 07/01/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Varies State and tribal Brownfields sites BROWNFIELDS: Completed Brownfields Covenants Listing Under Massachusetts law, M.G.L. c. 21E is the statute that governs the cleanup of releases of oil and/or hazardous material to the environment. The Brownfields Act of 1998 amended M.G.L. c. 21E by establishing significant liability relief and financial incentives to spur the redevelopment of brownfields, while ensuring that the Commonwealth’s environmental standards are met. Most brownfields are redeveloped with the benefit of liability protections that operate automatically under M.G.L. c. 21E. Date of Government Version: 01/01/2014 Date Data Arrived at EDR: 02/07/2014 Date Made Active in Reports: 03/14/2014 Number of Days to Update: 35 Source: Office of the Attorney General Telephone: 617-963-2423 Last EDR Contact: 05/09/2014 Next Scheduled EDR Contact: 08/18/2014 Data Release Frequency: Annually ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDS: A Listing of Brownfields Sites Brownfields are real property, the expansion, redevelopment, or reuse of which may be complicated by the presence or potential presence of a hazardous substance, pollutant, or contaminant. Cleaning up and reinvesting in these properties takes development pressures off of undeveloped, open land, and both improves and protects the environment. Assessment, Cleanup and Redevelopment Exchange System (ACRES) stores information reported by EPA Brownfields grant recipients on brownfields properties assessed or cleaned up with grant funding as well as information on Targeted Brownfields Assessments performed by EPA Regions. A listing of ACRES Brownfield sites is obtained from Cleanups in My Community. Cleanups in My Community provides information on Brownfields properties for which information is reported back to EPA, as well as areas served by Brownfields grant programs. Date of Government Version: 03/20/2014 Date Data Arrived at EDR: 03/20/2014 Date Made Active in Reports: 04/09/2014 Number of Days to Update: 20 Source: Environmental Protection Agency Telephone: 202-566-2777 Last EDR Contact: 07/03/2014 Next Scheduled EDR Contact: 10/06/2014 Data Release Frequency: Semi-Annually Local Lists of Landfill / Solid Waste Disposal Sites ODI: Open Dump Inventory An open dump is defined as a disposal facility that does not comply with one or more of the Part 257 or Part 258 Subtitle D Criteria. Date of Government Version: 06/30/1985 Date Data Arrived at EDR: 08/09/2004 Date Made Active in Reports: 09/17/2004 Number of Days to Update: 39 Source: Environmental Protection Agency Telephone: 800-424-9346 Last EDR Contact: 06/09/2004 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned DEBRIS REGION 9: Torres Martinez Reservation Illegal Dump Site Locations A listing of illegal dump sites location on the Torres Martinez Indian Reservation located in eastern Riverside County and northern Imperial County, California. TC4008590.2s Page GR-9 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 01/12/2009 Date Data Arrived at EDR: 05/07/2009 Date Made Active in Reports: 09/21/2009 Number of Days to Update: 137 Source: EPA, Region 9 Telephone: 415-947-4219 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: No Update Planned INDIAN ODI: Report on the Status of Open Dumps on Indian Lands Location of open dumps on Indian land. Date of Government Version: 12/31/1998 Date Data Arrived at EDR: 12/03/2007 Date Made Active in Reports: 01/24/2008 Number of Days to Update: 52 Source: Environmental Protection Agency Telephone: 703-308-8245 Last EDR Contact: 05/02/2014 Next Scheduled EDR Contact: 08/18/2014 Data Release Frequency: Varies Local Lists of Hazardous waste / Contaminated Sites US CDL: Clandestine Drug Labs A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this web site as a public service. It contains addresses of some locations where law enforcement agencies reported they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites. In most cases, the source of the entries is not the Department, and the Department has not verified the entry and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example, contacting local law enforcement and local health departments. Date of Government Version: 05/28/2014 Date Data Arrived at EDR: 06/20/2014 Date Made Active in Reports: 07/15/2014 Number of Days to Update: 25 Source: Drug Enforcement Administration Telephone: 202-307-1000 Last EDR Contact: 06/04/2014 Next Scheduled EDR Contact: 09/15/2014 Data Release Frequency: Quarterly US HIST CDL: National Clandestine Laboratory Register A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this web site as a public service. It contains addresses of some locations where law enforcement agencies reported they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites. In most cases, the source of the entries is not the Department, and the Department has not verified the entry and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example, contacting local law enforcement and local health departments. Date of Government Version: 05/28/2014 Date Data Arrived at EDR: 06/20/2014 Date Made Active in Reports: 07/15/2014 Number of Days to Update: 25 Source: Drug Enforcement Administration Telephone: 202-307-1000 Last EDR Contact: 06/04/2014 Next Scheduled EDR Contact: 09/15/2014 Data Release Frequency: No Update Planned Local Land Records LIENS 2: CERCLA Lien Information A Federal CERCLA (’Superfund’) lien can exist by operation of law at any site or property at which EPA has spent Superfund monies. These monies are spent to investigate and address releases and threatened releases of contamination. CERCLIS provides information as to the identity of these sites and properties. Date of Government Version: 02/18/2014 Date Data Arrived at EDR: 03/18/2014 Date Made Active in Reports: 04/24/2014 Number of Days to Update: 37 Source: Environmental Protection Agency Telephone: 202-564-6023 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies TC4008590.2s Page GR-10 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING LIENS: Liens Information Listing A listing of environmental liens. Date of Government Version: 02/24/2014 Date Data Arrived at EDR: 02/27/2014 Date Made Active in Reports: 03/14/2014 Number of Days to Update: 15 Source: Department of Environmental Protection Telephone: 617-292-5628 Last EDR Contact: 06/09/2014 Next Scheduled EDR Contact: 09/08/2014 Data Release Frequency: Varies Records of Emergency Release Reports HMIRS: Hazardous Materials Information Reporting System Hazardous Materials Incident Report System. HMIRS contains hazardous material spill incidents reported to DOT. Date of Government Version: 03/31/2014 Date Data Arrived at EDR: 04/01/2014 Date Made Active in Reports: 07/15/2014 Number of Days to Update: 105 Source: U.S. Department of Transportation Telephone: 202-366-4555 Last EDR Contact: 07/01/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Annually RELEASE: Reportable Releases Contains information on all releases of oil and hazardous materials that have been reported to DEP Date of Government Version: 04/11/2014 Date Data Arrived at EDR: 04/15/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 23 Source: Department of Environmental Protection Telephone: 617-292-5990 Last EDR Contact: 07/15/2014 Next Scheduled EDR Contact: 10/27/2014 Data Release Frequency: Quarterly MA SPILLS: Historical Spill List The Spills Database was the release notification tracking system for spills that occurred prior to October 1, 1993. This information should be considered to be primarily of historical interest since all of the listed spills have either been cleaned up or assigned new tracking numbers and moved to the Reportable Releases or Sites Transition List databases. Date of Government Version: 09/30/1993 Date Data Arrived at EDR: 12/03/2003 Date Made Active in Reports: 12/31/2003 Number of Days to Update: 28 Source: Department of Environmental Protection Telephone: 617-292-5720 Last EDR Contact: 12/03/2003 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned SPILLS 80: SPILLS80 data from FirstSearch Spills 80 includes those spill and release records available from FirstSearch databases prior to 1990. Typically, they may include chemical, oil and/or hazardous substance spills recorded before 1990. Duplicate records that are already included in EDR incident and release records are not included in Spills 80. Date of Government Version: 03/10/1998 Date Data Arrived at EDR: 01/03/2013 Date Made Active in Reports: 03/05/2013 Number of Days to Update: 61 Source: FirstSearch Telephone: N/A Last EDR Contact: 01/03/2013 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned SPILLS 90: SPILLS90 data from FirstSearch Spills 90 includes those spill and release records available exclusively from FirstSearch databases. Typically, they may include chemical, oil and/or hazardous substance spills recorded after 1990. Duplicate records that are already included in EDR incident and release records are not included in Spills 90. Date of Government Version: 12/11/2012 Date Data Arrived at EDR: 01/03/2013 Date Made Active in Reports: 02/08/2013 Number of Days to Update: 36 Source: FirstSearch Telephone: N/A Last EDR Contact: 01/03/2013 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned TC4008590.2s Page GR-11 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Other Ascertainable Records RCRA NonGen / NLR: RCRA - Non Generators RCRAInfo is EPA’s comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators do not presently generate hazardous waste. Date of Government Version: 03/11/2014 Date Data Arrived at EDR: 03/13/2014 Date Made Active in Reports: 04/09/2014 Number of Days to Update: 27 Source: Environmental Protection Agency Telephone: (888) 372-7341 Last EDR Contact: 07/02/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Varies DOT OPS: Incident and Accident Data Department of Transporation, Office of Pipeline Safety Incident and Accident data. Date of Government Version: 07/31/2012 Date Data Arrived at EDR: 08/07/2012 Date Made Active in Reports: 09/18/2012 Number of Days to Update: 42 Source: Department of Transporation, Office of Pipeline Safety Telephone: 202-366-4595 Last EDR Contact: 05/06/2014 Next Scheduled EDR Contact: 08/18/2014 Data Release Frequency: Varies DOD: Department of Defense Sites This data set consists of federally owned or administered lands, administered by the Department of Defense, that have any area equal to or greater than 640 acres of the United States, Puerto Rico, and the U.S. Virgin Islands. Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 11/10/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 62 Source: USGS Telephone: 888-275-8747 Last EDR Contact: 04/18/2014 Next Scheduled EDR Contact: 07/28/2014 Data Release Frequency: Semi-Annually FUDS: Formerly Used Defense Sites The listing includes locations of Formerly Used Defense Sites properties where the US Army Corps of Engineers is actively working or will take necessary cleanup actions. Date of Government Version: 12/31/2012 Date Data Arrived at EDR: 02/28/2014 Date Made Active in Reports: 04/24/2014 Number of Days to Update: 55 Source: U.S. Army Corps of Engineers Telephone: 202-528-4285 Last EDR Contact: 06/04/2014 Next Scheduled EDR Contact: 09/22/2014 Data Release Frequency: Varies CONSENT: Superfund (CERCLA) Consent Decrees Major legal settlements that establish responsibility and standards for cleanup at NPL (Superfund) sites. Released periodically by United States District Courts after settlement by parties to litigation matters. Date of Government Version: 12/31/2013 Date Data Arrived at EDR: 01/24/2014 Date Made Active in Reports: 02/24/2014 Number of Days to Update: 31 Source: Department of Justice, Consent Decree Library Telephone: Varies Last EDR Contact: 06/30/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Varies ROD: Records Of Decision Record of Decision. ROD documents mandate a permanent remedy at an NPL (Superfund) site containing technical and health information to aid in the cleanup. Date of Government Version: 11/25/2013 Date Data Arrived at EDR: 12/12/2013 Date Made Active in Reports: 02/24/2014 Number of Days to Update: 74 Source: EPA Telephone: 703-416-0223 Last EDR Contact: 06/10/2014 Next Scheduled EDR Contact: 09/22/2014 Data Release Frequency: Annually TC4008590.2s Page GR-12 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING UMTRA: Uranium Mill Tailings Sites Uranium ore was mined by private companies for federal government use in national defense programs. When the mills shut down, large piles of the sand-like material (mill tailings) remain after uranium has been extracted from the ore. Levels of human exposure to radioactive materials from the piles are low; however, in some cases tailings were used as construction materials before the potential health hazards of the tailings were recognized. Date of Government Version: 09/14/2010 Date Data Arrived at EDR: 10/07/2011 Date Made Active in Reports: 03/01/2012 Number of Days to Update: 146 Source: Department of Energy Telephone: 505-845-0011 Last EDR Contact: 02/25/2014 Next Scheduled EDR Contact: 06/09/2014 Data Release Frequency: Varies US MINES: Mines Master Index File Contains all mine identification numbers issued for mines active or opened since 1971. The data also includes violation information. Date of Government Version: 01/30/2014 Date Data Arrived at EDR: 03/05/2014 Date Made Active in Reports: 07/15/2014 Number of Days to Update: 132 Source: Department of Labor, Mine Safety and Health Administration Telephone: 303-231-5959 Last EDR Contact: 06/06/2014 Next Scheduled EDR Contact: 09/15/2014 Data Release Frequency: Semi-Annually TRIS: Toxic Chemical Release Inventory System Toxic Release Inventory System. TRIS identifies facilities which release toxic chemicals to the air, water and land in reportable quantities under SARA Title III Section 313. Date of Government Version: 12/31/2011 Date Data Arrived at EDR: 07/31/2013 Date Made Active in Reports: 09/13/2013 Number of Days to Update: 44 Source: EPA Telephone: 202-566-0250 Last EDR Contact: 05/30/2014 Next Scheduled EDR Contact: 09/08/2014 Data Release Frequency: Annually TSCA: Toxic Substances Control Act Toxic Substances Control Act. TSCA identifies manufacturers and importers of chemical substances included on the TSCA Chemical Substance Inventory list. It includes data on the production volume of these substances by plant site. Date of Government Version: 12/31/2006 Date Data Arrived at EDR: 09/29/2010 Date Made Active in Reports: 12/02/2010 Number of Days to Update: 64 Source: EPA Telephone: 202-260-5521 Last EDR Contact: 06/25/2014 Next Scheduled EDR Contact: 10/06/2014 Data Release Frequency: Every 4 Years FTTS: FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act) FTTS tracks administrative cases and pesticide enforcement actions and compliance activities related to FIFRA, TSCA and EPCRA (Emergency Planning and Community Right-to-Know Act). To maintain currency, EDR contacts the Agency on a quarterly basis. Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009 Date Made Active in Reports: 05/11/2009 Number of Days to Update: 25 Source: EPA/Office of Prevention, Pesticides and Toxic Substances Telephone: 202-566-1667 Last EDR Contact: 05/22/2014 Next Scheduled EDR Contact: 09/08/2014 Data Release Frequency: Quarterly FTTS INSP: FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act) A listing of FIFRA/TSCA Tracking System (FTTS) inspections and enforcements. Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009 Date Made Active in Reports: 05/11/2009 Number of Days to Update: 25 Source: EPA Telephone: 202-566-1667 Last EDR Contact: 05/22/2014 Next Scheduled EDR Contact: 09/08/2014 Data Release Frequency: Quarterly TC4008590.2s Page GR-13 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING HIST FTTS: FIFRA/TSCA Tracking System Administrative Case Listing A complete administrative case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that may not be included in the newer FTTS database updates. This database is no longer updated. Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007 Date Made Active in Reports: 04/10/2007 Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: 202-564-2501 Last EDR Contact: 12/17/2007 Next Scheduled EDR Contact: 03/17/2008 Data Release Frequency: No Update Planned HIST FTTS INSP: FIFRA/TSCA Tracking System Inspection & Enforcement Case Listing A complete inspection and enforcement case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that may not be included in the newer FTTS database updates. This database is no longer updated. Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007 Date Made Active in Reports: 04/10/2007 Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: 202-564-2501 Last EDR Contact: 12/17/2008 Next Scheduled EDR Contact: 03/17/2008 Data Release Frequency: No Update Planned SSTS: Section 7 Tracking Systems Section 7 of the Federal Insecticide, Fungicide and Rodenticide Act, as amended (92 Stat. 829) requires all registered pesticide-producing establishments to submit a report to the Environmental Protection Agency by March 1st each year. Each establishment must report the types and amounts of pesticides, active ingredients and devices being produced, and those having been produced and sold or distributed in the past year. Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/10/2010 Date Made Active in Reports: 02/25/2011 Number of Days to Update: 77 Source: EPA Telephone: 202-564-4203 Last EDR Contact: 04/29/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Annually ICIS: Integrated Compliance Information System The Integrated Compliance Information System (ICIS) supports the information needs of the national enforcement and compliance program as well as the unique needs of the National Pollutant Discharge Elimination System (NPDES) program. Date of Government Version: 05/06/2014 Date Data Arrived at EDR: 05/16/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 202-564-5088 Last EDR Contact: 10/09/2014 Next Scheduled EDR Contact: 10/27/2014 Data Release Frequency: Quarterly PADS: PCB Activity Database System PCB Activity Database. PADS Identifies generators, transporters, commercial storers and/or brokers and disposers of PCB’s who are required to notify the EPA of such activities. Date of Government Version: 06/01/2013 Date Data Arrived at EDR: 07/17/2013 Date Made Active in Reports: 11/01/2013 Number of Days to Update: 107 Source: EPA Telephone: 202-566-0500 Last EDR Contact: 04/18/2014 Next Scheduled EDR Contact: 07/28/2014 Data Release Frequency: Annually TC4008590.2s Page GR-14 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING MLTS: Material Licensing Tracking System MLTS is maintained by the Nuclear Regulatory Commission and contains a list of approximately 8,100 sites which possess or use radioactive materials and which are subject to NRC licensing requirements. To maintain currency, EDR contacts the Agency on a quarterly basis. Date of Government Version: 07/22/2013 Date Data Arrived at EDR: 08/02/2013 Date Made Active in Reports: 11/01/2013 Number of Days to Update: 91 Source: Nuclear Regulatory Commission Telephone: 301-415-7169 Last EDR Contact: 06/05/2014 Next Scheduled EDR Contact: 09/22/2014 Data Release Frequency: Quarterly RADINFO: Radiation Information Database The Radiation Information Database (RADINFO) contains information about facilities that are regulated by U.S. Environmental Protection Agency (EPA) regulations for radiation and radioactivity. Date of Government Version: 04/08/2014 Date Data Arrived at EDR: 04/09/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 69 Source: Environmental Protection Agency Telephone: 202-343-9775 Last EDR Contact: 07/10/2014 Next Scheduled EDR Contact: 10/20/2014 Data Release Frequency: Quarterly FINDS: Facility Index System/Facility Registry System Facility Index System. FINDS contains both facility information and ’pointers’ to other sources that contain more detail. EDR includes the following FINDS databases in this report: PCS (Permit Compliance System), AIRS (Aerometric Information Retrieval System), DOCKET (Enforcement Docket used to manage and track information on civil judicial enforcement cases for all environmental statutes), FURS (Federal Underground Injection Control), C-DOCKET (Criminal Docket System used to track criminal enforcement actions for all environmental statutes), FFIS (Federal Facilities Information System), STATE (State Environmental Laws and Statutes), and PADS (PCB Activity Data System). Date of Government Version: 11/18/2013 Date Data Arrived at EDR: 02/27/2014 Date Made Active in Reports: 03/12/2014 Number of Days to Update: 13 Source: EPA Telephone: (617) 918-1111 Last EDR Contact: 06/13/2014 Next Scheduled EDR Contact: 09/22/2014 Data Release Frequency: Quarterly RAATS: RCRA Administrative Action Tracking System RCRA Administration Action Tracking System. RAATS contains records based on enforcement actions issued under RCRA pertaining to major violators and includes administrative and civil actions brought by the EPA. For administration actions after September 30, 1995, data entry in the RAATS database was discontinued. EPA will retain a copy of the database for historical records. It was necessary to terminate RAATS because a decrease in agency resources made it impossible to continue to update the information contained in the database. Date of Government Version: 04/17/1995 Date Data Arrived at EDR: 07/03/1995 Date Made Active in Reports: 08/07/1995 Number of Days to Update: 35 Source: EPA Telephone: 202-564-4104 Last EDR Contact: 06/02/2008 Next Scheduled EDR Contact: 09/01/2008 Data Release Frequency: No Update Planned RMP: Risk Management Plans TC4008590.2s Page GR-15 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING When Congress passed the Clean Air Act Amendments of 1990, it required EPA to publish regulations and guidance for chemical accident prevention at facilities using extremely hazardous substances. The Risk Management Program Rule (RMP Rule) was written to implement Section 112(r) of these amendments. The rule, which built upon existing industry codes and standards, requires companies of all sizes that use certain flammable and toxic substances to develop a Risk Management Program, which includes a(n): Hazard assessment that details the potential effects of an accidental release, an accident history of the last five years, and an evaluation of worst-case and alternative accidental releases; Prevention program that includes safety precautions and maintenance, monitoring, and employee training measures; and Emergency response program that spells out emergency health care, employee training measures and procedures for informing the public and response agencies (e.g the fire department) should an accident occur. Date of Government Version: 11/01/2013 Date Data Arrived at EDR: 12/12/2013 Date Made Active in Reports: 02/13/2014 Number of Days to Update: 63 Source: Environmental Protection Agency Telephone: 202-564-8600 Last EDR Contact: 04/28/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies BRS: Biennial Reporting System The Biennial Reporting System is a national system administered by the EPA that collects data on the generation and management of hazardous waste. BRS captures detailed data from two groups: Large Quantity Generators (LQG) and Treatment, Storage, and Disposal Facilities. Date of Government Version: 12/31/2011 Date Data Arrived at EDR: 02/26/2013 Date Made Active in Reports: 04/19/2013 Number of Days to Update: 52 Source: EPA/NTIS Telephone: 800-424-9346 Last EDR Contact: 05/30/2014 Next Scheduled EDR Contact: 09/08/2014 Data Release Frequency: Biennially NPDES: NPDES Permit Listing Listing of treatment plants in Massachusetts that hold permits to discharge to groundwater. Date of Government Version: 02/18/2014 Date Data Arrived at EDR: 02/21/2014 Date Made Active in Reports: 03/14/2014 Number of Days to Update: 21 Source: Department of Environmental Protection Telephone: 508-767-2781 Last EDR Contact: 05/23/2014 Next Scheduled EDR Contact: 09/01/2014 Data Release Frequency: Varies DRYCLEANERS: Regulated Drycleaning Facilities A listing of Department of Environmental Protection regulated drycleaning facilities that use perchloroethylene under the Environmental Results Program. Date of Government Version: 05/01/2014 Date Data Arrived at EDR: 05/01/2014 Date Made Active in Reports: 05/06/2014 Number of Days to Update: 5 Source: Department of Environmental Protection Telephone: 617-292-5633 Last EDR Contact: 04/21/2014 Next Scheduled EDR Contact: 08/04/2014 Data Release Frequency: Varies ENFORCEMENT: Enforcement Action Cases A listing of enforcement action cases tracked by Department of Environmental Protection programs, including Solid Waste and Hazardous Waste. Date of Government Version: 08/01/2004 Date Data Arrived at EDR: 09/01/2004 Date Made Active in Reports: 10/01/2004 Number of Days to Update: 30 Source: Department of Environmental Quality Telephone: 617-292-5979 Last EDR Contact: 02/17/2014 Next Scheduled EDR Contact: 05/19/2014 Data Release Frequency: Varies AIRS: Permitted Facilities Listing A listing of Air Quality permit applications. TC4008590.2s Page GR-16 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 04/24/2014 Date Data Arrived at EDR: 04/25/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 13 Source: Department of Environmental Protection Telephone: 617-292-5789 Last EDR Contact: 04/21/2014 Next Scheduled EDR Contact: 08/04/2014 Data Release Frequency: Varies TIER 2: Tier 2 Information Listing A listing of facilities which store or manufacture hazardous materials and submit a chemical inventory report Date of Government Version: 12/31/2012 Date Data Arrived at EDR: 12/19/2013 Date Made Active in Reports: 01/30/2014 Number of Days to Update: 42 Source: Massachusetts Emergency Management Agency Telephone: 508-820-2019 Last EDR Contact: 04/21/2014 Next Scheduled EDR Contact: 08/04/2014 Data Release Frequency: Annually LEAD: Lead Inspection Database The Massachusetts Childhood Lead Poisoning Prevention Program data of lead inspection for the state. Date of Government Version: 04/10/2014 Date Data Arrived at EDR: 04/17/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 21 Source: Department of Health & Human Services, Childhood Lead Poisoning Prevention Progr Telephone: 617-624-5757 Last EDR Contact: 06/17/2014 Next Scheduled EDR Contact: 10/06/2014 Data Release Frequency: Varies INDIAN RESERV: Indian Reservations This map layer portrays Indian administered lands of the United States that have any area equal to or greater than 640 acres. Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 12/08/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 34 Source: USGS Telephone: 202-208-3710 Last EDR Contact: 04/18/2014 Next Scheduled EDR Contact: 07/28/2014 Data Release Frequency: Semi-Annually SCRD DRYCLEANERS: State Coalition for Remediation of Drycleaners Listing The State Coalition for Remediation of Drycleaners was established in 1998, with support from the U.S. EPA Office of Superfund Remediation and Technology Innovation. It is comprised of representatives of states with established drycleaner remediation programs. Currently the member states are Alabama, Connecticut, Florida, Illinois, Kansas, Minnesota, Missouri, North Carolina, Oregon, South Carolina, Tennessee, Texas, and Wisconsin. Date of Government Version: 03/07/2011 Date Data Arrived at EDR: 03/09/2011 Date Made Active in Reports: 05/02/2011 Number of Days to Update: 54 Source: Environmental Protection Agency Telephone: 615-532-8599 Last EDR Contact: 04/21/2014 Next Scheduled EDR Contact: 08/04/2014 Data Release Frequency: Varies FEDLAND: Federal and Indian Lands Federally and Indian administrated lands of the United States. Lands included are administrated by: Army Corps of Engineers, Bureau of Reclamation, National Wild and Scenic River, National Wildlife Refuge, Public Domain Land, Wilderness, Wilderness Study Area, Wildlife Management Area, Bureau of Indian Affairs, Bureau of Land Management, Department of Justice, Forest Service, Fish and Wildlife Service, National Park Service. Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 02/06/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 339 Source: U.S. Geological Survey Telephone: 888-275-8747 Last EDR Contact: 04/18/2014 Next Scheduled EDR Contact: 07/28/2014 Data Release Frequency: N/A EPA WATCH LIST: EPA WATCH LIST EPA maintains a "Watch List" to facilitate dialogue between EPA, state and local environmental agencies on enforcement matters relating to facilities with alleged violations identified as either significant or high priority. Being on the Watch List does not mean that the facility has actually violated the law only that an investigation by EPA or a state or local environmental agency has led those organizations to allege that an unproven violation has in fact occurred. Being on the Watch List does not represent a higher level of concern regarding the alleged violations that were detected, but instead indicates cases requiring additional dialogue between EPA, state and local agencies - primarily because of the length of time the alleged violation has gone unaddressed or unresolved. TC4008590.2s Page GR-17 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 08/30/2013 Date Data Arrived at EDR: 03/21/2014 Date Made Active in Reports: 06/17/2014 Number of Days to Update: 88 Source: Environmental Protection Agency Telephone: 617-520-3000 Last EDR Contact: 05/16/2014 Next Scheduled EDR Contact: 08/25/2014 Data Release Frequency: Quarterly LEAD SMELTER 2: Lead Smelter Sites A list of several hundred sites in the U.S. where secondary lead smelting was done from 1931and 1964. These sites may pose a threat to public health through ingestion or inhalation of contaminated soil or dust Date of Government Version: 04/05/2001 Date Data Arrived at EDR: 10/27/2010 Date Made Active in Reports: 12/02/2010 Number of Days to Update: 36 Source: American Journal of Public Health Telephone: 703-305-6451 Last EDR Contact: 12/02/2009 Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned MERCURY: Mercury Product Recyling Drop-Off Locations Listing A listing of locations, collecting and recycling for mercury-added products. Mercury is toxic to the human nervous system, as well as fish and animals. Mercury can enter the body either through skin absorption or through inhalation of mercury vapors. At room temperature, small beads of mercury will vaporize. Date of Government Version: 09/17/2013 Date Data Arrived at EDR: 11/26/2013 Date Made Active in Reports: 01/16/2014 Number of Days to Update: 51 Source: Department of Environmental Protection Telephone: 617-292-5632 Last EDR Contact: 05/30/2014 Next Scheduled EDR Contact: 09/08/2014 Data Release Frequency: Varies PRP: Potentially Responsible Parties A listing of verified Potentially Responsible Parties Date of Government Version: 04/15/2013 Date Data Arrived at EDR: 07/03/2013 Date Made Active in Reports: 09/13/2013 Number of Days to Update: 72 Source: EPA Telephone: 202-564-6023 Last EDR Contact: 07/01/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Quarterly US FIN ASSUR: Financial Assurance Information All owners and operators of facilities that treat, store, or dispose of hazardous waste are required to provide proof that they will have sufficient funds to pay for the clean up, closure, and post-closure care of their facilities. Date of Government Version: 02/25/2014 Date Data Arrived at EDR: 02/27/2014 Date Made Active in Reports: 04/09/2014 Number of Days to Update: 41 Source: Environmental Protection Agency Telephone: 202-566-1917 Last EDR Contact: 05/16/2014 Next Scheduled EDR Contact: 09/01/2014 Data Release Frequency: Quarterly Financial Assurance 2: Financial Assurance Information Listing A listing of financial assurance information for underground storage tanks. Financial assurance is intended to ensure that resources are available to pay for the cost of closure, post-closure care, and corrective measures if the owner or operator of a regulated facility is unable or unwilling to pay. Date of Government Version: 10/21/2011 Date Data Arrived at EDR: 10/25/2011 Date Made Active in Reports: 11/18/2011 Number of Days to Update: 24 Source: Office of State Fire Marshal Telephone: 978-567-3100 Last EDR Contact: 04/21/2014 Next Scheduled EDR Contact: 08/04/2014 Data Release Frequency: Quarterly PCB TRANSFORMER: PCB Transformer Registration Database The database of PCB transformer registrations that includes all PCB registration submittals. TC4008590.2s Page GR-18 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: 02/01/2011 Date Data Arrived at EDR: 10/19/2011 Date Made Active in Reports: 01/10/2012 Number of Days to Update: 83 Source: Environmental Protection Agency Telephone: 202-566-0517 Last EDR Contact: 05/02/2014 Next Scheduled EDR Contact: 08/11/2014 Data Release Frequency: Varies Financial Assurance 3: Financial Assurance Information listing Information for solid waste facilities. Financial assurance is intended to ensure that resources are available to pay for the cost of closure, post-closure care, and corrective measures if the owner or operator of a regulated facility is unable or unwilling to pay Date of Government Version: 12/31/2012 Date Data Arrived at EDR: 09/25/2013 Date Made Active in Reports: 10/10/2013 Number of Days to Update: 15 Source: Department of Environmental Protection Telephone: 617-292-5970 Last EDR Contact: 07/14/2014 Next Scheduled EDR Contact: 10/27/2014 Data Release Frequency: Varies US AIRS MINOR: Air Facility System Data A listing of minor source facilities. Date of Government Version: 10/23/2013 Date Data Arrived at EDR: 11/06/2013 Date Made Active in Reports: 12/06/2013 Number of Days to Update: 30 Source: EPA Telephone: 202-564-2496 Last EDR Contact: 06/25/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Annually US AIRS (AFS): Aerometric Information Retrieval System Facility Subsystem (AFS) The database is a sub-system of Aerometric Information Retrieval System (AIRS). AFS contains compliance data on air pollution point sources regulated by the U.S. EPA and/or state and local air regulatory agencies. This information comes from source reports by various stationary sources of air pollution, such as electric power plants, steel mills, factories, and universities, and provides information about the air pollutants they produce. Action, air program, air program pollutant, and general level plant data. It is used to track emissions and compliance data from industrial plants. Date of Government Version: 10/23/2013 Date Data Arrived at EDR: 11/06/2013 Date Made Active in Reports: 12/06/2013 Number of Days to Update: 30 Source: EPA Telephone: 202-564-2496 Last EDR Contact: 06/25/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Annually LEAD SMELTER 1: Lead Smelter Sites A listing of former lead smelter site locations. Date of Government Version: 01/29/2013 Date Data Arrived at EDR: 02/14/2013 Date Made Active in Reports: 02/27/2013 Number of Days to Update: 13 Source: Environmental Protection Agency Telephone: 703-603-8787 Last EDR Contact: 07/01/2014 Next Scheduled EDR Contact: 10/20/2014 Data Release Frequency: Varies 2020 COR ACTION: 2020 Corrective Action Program List The EPA has set ambitious goals for the RCRA Corrective Action program by creating the 2020 Corrective Action Universe. This RCRA cleanup baseline includes facilities expected to need corrective action. The 2020 universe contains a wide variety of sites. Some properties are heavily contaminated while others were contaminated but have since been cleaned up. Still others have not been fully investigated yet, and may require little or no remediation. Inclusion in the 2020 Universe does not necessarily imply failure on the part of a facility to meet its RCRA obligations. Date of Government Version: 11/11/2011 Date Data Arrived at EDR: 05/18/2012 Date Made Active in Reports: 05/25/2012 Number of Days to Update: 7 Source: Environmental Protection Agency Telephone: 703-308-4044 Last EDR Contact: 05/16/2014 Next Scheduled EDR Contact: 08/25/2014 Data Release Frequency: Varies TC4008590.2s Page GR-19 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING TSD: TSD Facility List of Licensed Hazardous Waste Treatment, Storage Disposal Facilities (TSDFs) in Massachusetts. Date of Government Version: 11/01/2009 Date Data Arrived at EDR: 06/04/2013 Date Made Active in Reports: 07/18/2013 Number of Days to Update: 44 Source: Department of Environmental Protection Telephone: 617-292-5580 Last EDR Contact: 07/03/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Varies HW GEN: List of Massachusetts Hazardous Waste Generators Permanent generator identification numbers for all Massachusetts generators of hazardous waste and waste oil that have registered with or notified MassDEP of their hazardous waste activities. Date of Government Version: 03/24/2014 Date Data Arrived at EDR: 04/01/2014 Date Made Active in Reports: 05/08/2014 Number of Days to Update: 37 Source: Department of Environmental Protection Telephone: 617-292-5500 Last EDR Contact: 07/01/2014 Next Scheduled EDR Contact: 10/13/2014 Data Release Frequency: Semi-Annually GWDP: Ground Water Discharge Permits The Ground Water Discharge Permits datalayer (formerly known as Groundwater Discharge Points) is a statewide point dataset containing approximate locations of permitted discharges to groundwater. Date of Government Version: 09/01/2011 Date Data Arrived at EDR: 11/08/2011 Date Made Active in Reports: 12/05/2011 Number of Days to Update: 27 Source: MassGIS Telephone: 617-556-1150 Last EDR Contact: 05/09/2014 Next Scheduled EDR Contact: 08/18/2014 Data Release Frequency: Varies COAL ASH EPA: Coal Combustion Residues Surface Impoundments List A listing of coal combustion residues surface impoundments with high hazard potential ratings. Date of Government Version: 08/17/2010 Date Data Arrived at EDR: 01/03/2011 Date Made Active in Reports: 03/21/2011 Number of Days to Update: 77 Source: Environmental Protection Agency Telephone: N/A Last EDR Contact: 06/11/2014 Next Scheduled EDR Contact: 09/22/2014 Data Release Frequency: Varies Financial Assurance 1: Financial Assurance Information Listing Information for hazardous waste facilities. Financial assurance is intended to ensure that resources are available to pay for the cost of closure, post-closure care, and corrective measures if the owner or operator of a regulated facility is unable or unwilling to pay. Date of Government Version: 12/01/2010 Date Data Arrived at EDR: 12/23/2010 Date Made Active in Reports: 02/03/2011 Number of Days to Update: 42 Source: Department of Environmental Protection Telephone: 617-292-5970 Last EDR Contact: 06/11/2014 Next Scheduled EDR Contact: 09/29/2014 Data Release Frequency: Varies COAL ASH DOE: Sleam-Electric Plan Operation Data A listing of power plants that store ash in surface ponds. Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 08/07/2009 Date Made Active in Reports: 10/22/2009 Number of Days to Update: 76 Source: Department of Energy Telephone: 202-586-8719 Last EDR Contact: 04/18/2014 Next Scheduled EDR Contact: 07/28/2014 Data Release Frequency: Varies TC4008590.2s Page GR-20 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING EDR HIGH RISK HISTORICAL RECORDS EDR Exclusive Records EDR MGP: EDR Proprietary Manufactured Gas Plants The EDR Proprietary Manufactured Gas Plant Database includes records of coal gas plants (manufactured gas plants) compiled by EDR’s researchers. Manufactured gas sites were used in the United States from the 1800’s to 1950’s to produce a gas that could be distributed and used as fuel. These plants used whale oil, rosin, coal, or a mixture of coal, oil, and water that also produced a significant amount of waste. Many of the byproducts of the gas production, such as coal tar (oily waste containing volatile and non-volatile chemicals), sludges, oils and other compounds are potentially hazardous to human health and the environment. The byproduct from this process was frequently disposed of directly at the plant site and can remain or spread slowly, serving as a continuous source of soil and groundwater contamination. Date of Government Version: N/A Date Data Arrived at EDR: N/A Date Made Active in Reports: N/A Number of Days to Update: N/A Source: EDR, Inc. Telephone: N/A Last EDR Contact: N/A Next Scheduled EDR Contact: N/A Data Release Frequency: No Update Planned EDR US Hist Auto Stat: EDR Exclusive Historic Gas Stations EDR has searched selected national collections of business directories and has collected listings of potential gas station/filling station/service station sites that were available to EDR researchers. EDR’s review was limited to those categories of sources that might, in EDR’s opinion, include gas station/filling station/service station establishments. The categories reviewed included, but were not limited to gas, gas station, gasoline station, filling station, auto, automobile repair, auto service station, service station, etc. This database falls within a category of information EDR classifies as "High Risk Historical Records", or HRHR. EDR’s HRHR effort presents unique and sometimes proprietary data about past sites and operations that typically create environmental concerns, but may not show up in current government records searches. Date of Government Version: N/A Date Data Arrived at EDR: N/A Date Made Active in Reports: N/A Number of Days to Update: N/A Source: EDR, Inc. Telephone: N/A Last EDR Contact: N/A Next Scheduled EDR Contact: N/A Data Release Frequency: Varies EDR US Hist Cleaners: EDR Exclusive Historic Dry Cleaners EDR has searched selected national collections of business directories and has collected listings of potential dry cleaner sites that were available to EDR researchers. EDR’s review was limited to those categories of sources that might, in EDR’s opinion, include dry cleaning establishments. The categories reviewed included, but were not limited to dry cleaners, cleaners, laundry, laundromat, cleaning/laundry, wash & dry etc. This database falls within a category of information EDR classifies as "High Risk Historical Records", or HRHR. EDR’s HRHR effort presents unique and sometimes proprietary data about past sites and operations that typically create environmental concerns, but may not show up in current government records searches. Date of Government Version: N/A Date Data Arrived at EDR: N/A Date Made Active in Reports: N/A Number of Days to Update: N/A Source: EDR, Inc. Telephone: N/A Last EDR Contact: N/A Next Scheduled EDR Contact: N/A Data Release Frequency: Varies EDR RECOVERED GOVERNMENT ARCHIVES Exclusive Recovered Govt. Archives RGA HWS: Recovered Government Archive State Hazardous Waste Facilities List The EDR Recovered Government Archive State Hazardous Waste database provides a list of SHWS incidents derived from historical databases and includes many records that no longer appear in current government lists. Compiled from Records formerly available from the Department of Environmental Protection in Massachusetts. TC4008590.2s Page GR-21 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Date of Government Version: N/A Date Data Arrived at EDR: 07/01/2013 Date Made Active in Reports: 12/24/2013 Number of Days to Update: 176 Source: Department of Environmental Protection Telephone: N/A Last EDR Contact: 06/01/2012 Next Scheduled EDR Contact: N/A Data Release Frequency: Varies RGA LUST: Recovered Government Archive Leaking Underground Storage Tank The EDR Recovered Government Archive Leaking Underground Storage Tank database provides a list of LUST incidents derived from historical databases and includes many records that no longer appear in current government lists. Compiled from Records formerly available from the Department of Environmental Protection in Massachusetts. Date of Government Version: N/A Date Data Arrived at EDR: 07/01/2013 Date Made Active in Reports: 12/24/2013 Number of Days to Update: 176 Source: Department of Environmental Protection Telephone: N/A Last EDR Contact: 06/01/2012 Next Scheduled EDR Contact: N/A Data Release Frequency: Varies OTHER DATABASE(S) Depending on the geographic area covered by this report, the data provided in these specialty databases may or may not be complete. For example, the existence of wetlands information data in a specific report does not mean that all wetlands in the area covered by the report are included. Moreover, the absence of any reported wetlands information does not necessarily mean that wetlands do not exist in the area covered by the report. Oil/Gas Pipelines:This data was obtained by EDR from the USGS in 1994. It is referred to by USGS as GeoData Digital Line Graphs from 1:100,000-Scale Maps. It was extracted from the transportation category including some oil, but primarily gas pipelines. Electric Power Transmission Line Data Source: Rextag Strategies Corp. Telephone: (281) 769-2247 U.S. Electric Transmission and Power Plants Systems Digital GIS Data Sensitive Receptors:There are individuals deemed sensitive receptors due to their fragile immune systems and special sensitivity to environmental discharges. These sensitive receptors typically include the elderly, the sick, and children. While the location of all sensitive receptors cannot be determined, EDR indicates those buildings and facilities - schools, daycares, hospitals, medical centers, and nursing homes - where individuals who are sensitive receptors are likely to be located. AHA Hospitals: Source: American Hospital Association, Inc. Telephone: 312-280-5991 The database includes a listing of hospitals based on the American Hospital Association’s annual survey of hospitals. Medical Centers: Provider of Services Listing Source: Centers for Medicare & Medicaid Services Telephone: 410-786-3000 A listing of hospitals with Medicare provider number, produced by Centers of Medicare & Medicaid Services, a federal agency within the U.S. Department of Health and Human Services. Nursing Homes Source: National Institutes of Health Telephone: 301-594-6248 Information on Medicare and Medicaid certified nursing homes in the United States. Public Schools Source: National Center for Education Statistics Telephone: 202-502-7300 The National Center for Education Statistics’ primary database on elementary and secondary public education in the United States. It is a comprehensive, annual, national statistical database of all public elementary and secondary schools and school districts, which contains data that are comparable across all states. Private Schools Source: National Center for Education Statistics Telephone: 202-502-7300 The National Center for Education Statistics’ primary database on private school locations in the United States. TC4008590.2s Page GR-22 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING Flood Zone Data:This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA. NWI:National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002, 2005 and 2010 from the U.S. Fish and Wildlife Service. Areas of Critical Environmental Concern Datalayer:The Areas of Critical Environmental Concern (ACEC) datalayer shows the location of areas that have been designated ACECs by the Secretary of Environmental Affairs. ACEC designation requires greater environmental review of certain kinds of proposed development under state jurisdiction within the ACEC boundaries. The ACEC Program is administered by the Department of Environmental Management (DEM) on behalf of the Secretary of Environmental Affairs. The Massachusetts Coastal Zone Management (MCZM) Office managed the original Coastal ACEC Program from 1978 to 1993, and continues to play a key role in monitoring coastal ACECs. Procedures for ACEC designation and the general policies governing the effects of designation are contained in the ACEC regulations (301 CMR 12.00). The ACEC datalayer has been compiled by MCZM and DEM and includes both coastal and inland areas. Scanned Digital USGS 7.5’ Topographic Map (DRG) Source: United States Geologic Survey A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images are made by scanning published paper maps on high-resolution scanners. The raster image is georeferenced and fit to the Universal Transverse Mercator (UTM) projection. STREET AND ADDRESS INFORMATION © 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material. TC4008590.2s Page GR-23 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING TC4008590.2s Page A-1 geologic strata.of the soil, and nearby wells. Groundwater flow velocity is generally impacted by the nature of theGroundwater flow direction may be impacted by surface topography, hydrology, hydrogeology, characteristics 2. Groundwater flow velocity. 1. Groundwater flow direction, and Assessment of the impact of contaminant migration generally has two principal investigative components: forming an opinion about the impact of potential contaminant migration.EDR’s GeoCheck Physical Setting Source Addendum is provided to assist the environmental professional in 1979Most Recent Revision:42072-C6 EASTHAMPTON, MATarget Property Map: USGS TOPOGRAPHIC MAP 246 ft. above sea levelElevation:4685813.0UTM Y (Meters): 692915.9UTM X (Meters): Zone 18Universal Tranverse Mercator: 72.6596 - 72˚ 39’ 34.56’’Longitude (West): 42.3026 - 42˚ 18’ 9.36’’Latitude (North): TARGET PROPERTY COORDINATES NORTHAMPTON, MA 01060128 ROCKY HILL ROAD128 ROCKY HILL ROAD TARGET PROPERTY ADDRESS ®GEOCHECK - PHYSICAL SETTING SOURCE ADDENDUM® TC4008590.2s Page A-2 should be field verified.on a relative (not an absolute) basis. Relative elevation information between sites of close proximitySource: Topography has been determined from the USGS 7.5’ Digital Elevation Model and should be evaluated SURROUNDING TOPOGRAPHY: ELEVATION PROFILES El e v a t i o n ( f t ) El e v a t i o n ( f t ) TP TP 01/21 Miles✩Target Property Elevation: 246 ft. NorthSouth WestEast 15 6 15 1 20 7 21 6 21 0 23 2 28 0 29 928 2 24 6 20 3 21 2 23 0 25 1 23 9 23 5 25 4 25 0 24 0 27 6 27 4 29 8 33 7 29 4 25 8 25 3 25 9 27 1 24 6 18 7 14 0 13 7 10 6 10 9 10 9 10 9 10 9 10 9 General ENEGeneral Topographic Gradient:TARGET PROPERTY TOPOGRAPHY should contamination exist on the target property, what downgradient sites might be impacted.assist the environmental professional in forming an opinion about the impact of nearby contaminated properties or,Surface topography may be indicative of the direction of surficial groundwater flow. This information can be used to TOPOGRAPHIC INFORMATION collected on nearby properties, and regional groundwater flow information (from deep aquifers).sources of information, such as surface topographic information, hydrologic information, hydrogeologic datausing site-specific well data. If such data is not reasonably ascertainable, it may be necessary to rely on otherGroundwater flow direction for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW DIRECTION INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC4008590.2s Page A-3 Not Reported GENERAL DIRECTIONLOCATION GROUNDWATER FLOWFROM TPMAP ID hydrogeologically, and the depth to water table.authorities at select sites and has extracted the date of the report, groundwater flow direction as determinedflow at specific points. EDR has reviewed reports submitted by environmental professionals to regulatoryEDR has developed the AQUIFLOW Information System to provide data on the general direction of groundwater AQUIFLOW® Search Radius: 1.000 Mile. contamination exist on the target property, what downgradient sites might be impacted.environmental professional in forming an opinion about the impact of nearby contaminated properties or, shouldof groundwater flow direction in the immediate area. Such hydrogeologic information can be used to assist theHydrogeologic information obtained by installation of wells on a specific site can often be an indicator HYDROGEOLOGIC INFORMATION YES - refer to the Overview Map and Detail MapEASTHAMPTON NATIONAL WETLAND INVENTORY NWI ElectronicData CoverageNWI Quad at Target Property 2501600010B - FEMA Q3 Flood data2501670001A - FEMA Q3 Flood dataAdditional Panels in search area: 2501670002A - FEMA Q3 Flood dataFlood Plain Panel at Target Property: YES - refer to the Overview Map and Detail MapHAMPSHIRE, MA FEMA FLOOD ZONE FEMA FloodElectronic DataTarget Property County and bodies of water).Refer to the Physical Setting Source Map following this summary for hydrologic information (major waterways contamination exist on the target property, what downgradient sites might be impacted.the environmental professional in forming an opinion about the impact of nearby contaminated properties or, shouldSurface water can act as a hydrologic barrier to groundwater flow. Such hydrologic information can be used to assist HYDROLOGIC INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC4008590.2s Page A-4 > 60 inchesDepth to Bedrock Max: > 60 inchesDepth to Bedrock Min: LOWCorrosion Potential - Uncoated Steel: Hydric Status: Soil does not meet the requirements for a hydric soil. low water holding capacity. Depth to water table is more than 6 feet.Excessively. Soils have very high and high hydraulic conductivity andSoil Drainage Class: excessively drained sands and gravels.Class A - High infiltration rates. Soils are deep, well drained toHydrologic Group: loamy sandSoil Surface Texture: WINDSORSoil Component Name: The following information is based on Soil Conservation Service STATSGO data.in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO) soil survey maps.for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patternsSurvey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey informationThe U.S. Department of Agriculture’s (USDA) Soil Conservation Service (SCS) leads the National Cooperative Soil DOMINANT SOIL COMPOSITION IN GENERAL AREA OF TARGET PROPERTY Map, USGS Digital Data Series DDS - 11 (1994).of the Conterminous U.S. at 1:2,500,000 Scale - a digital representation of the 1974 P.B. King and H.M. BeikmanGeologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology ROCK STRATIGRAPHIC UNITGEOLOGIC AGE IDENTIFICATION Stratified SequenceCategory:MesozoicEra:TriassicSystem:TriassicSeries:TrCode: (decoded above as Era, System & Series) at which contaminant migration may be occurring.Geologic information can be used by the environmental professional in forming an opinion about the relative speed GEOLOGIC INFORMATION IN GENERAL AREA OF TARGET PROPERTY move more quickly through sandy-gravelly types of soils than silty-clayey types of soils.characteristics data collected on nearby properties and regional soil information. In general, contaminant plumesto rely on other sources of information, including geologic age identification, rock stratigraphic unit and soilusing site specific geologic and soil strata data. If such data are not reasonably ascertainable, it may be necessaryGroundwater flow velocity information for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW VELOCITY INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC4008590.2s Page A-5 sapric materialstratifiedDeeper Soil Types: silt loamloamy sandloamy coarse sandShallow Soil Types: mucky - loamy sandsilt loamextremely gravelly - sandloamy fine sandmuckfine sandy loamgravelly - sandy loamSurficial Soil Types: mucky - loamy sandsilt loamextremely gravelly - sandloamy fine sandmuckfine sandy loamgravelly - sandy loamSoil Surface Textures: appear within the general area of target property.Based on Soil Conservation Service STATSGO data, the following additional subordinant soil types may OTHER SOIL TYPES IN AREA Min: 4.50 Max: 6.50 Min: 6.00 Max: 20.00 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED Sand. Gravel and Fragments, 200), Stone passing No. pct. or less materials (35 Granularsand65 inches20 inches 3 Min: 4.50 Max: 6.00 Min: 6.00 Max: 20.00 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED Sand. Gravel and Fragments, 200), Stone passing No. pct. or less materials (35 Granularloamy sand20 inches 2 inches 2 Min: 4.50 Max: 6.00 Min: 6.00 Max: 20.00 Silty Sand. Sands with fines, SOILS, Sands, COARSE-GRAINED Sand. Gravel and Fragments, 200), Stone passing No. pct. or less materials (35 Granularloamy sand 2 inches 0 inches 1 Soil Layer Information BoundaryClassification PermeabilityRate (in/hr)LayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction(pH) ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® TC4008590.2s Page A-6 No Wells Found STATE DATABASE WELL INFORMATION LOCATION FROM TPWELL IDMAP ID Note: PWS System location is not always the same as well location. No PWS System Found FEDERAL FRDS PUBLIC WATER SUPPLY SYSTEM INFORMATION LOCATION FROM TPWELL IDMAP ID 1/2 - 1 Mile WestUSGS40000471739 1 FEDERAL USGS WELL INFORMATION LOCATION FROM TPWELL IDMAP ID 1.000State Database Nearest PWS within 1 mileFederal FRDS PWS 1.000Federal USGS WELL SEARCH DISTANCE INFORMATION SEARCH DISTANCE (miles)DATABASE opinion about the impact of contaminant migration on nearby drinking water wells.professional in assessing sources that may impact ground water flow direction, and in forming anEDR Local/Regional Water Agency records provide water well information to assist the environmental LOCAL / REGIONAL WATER AGENCY RECORDS silt loamcoarse sandextremely gravelly - sand ®GEOCHECK - PHYSICAL SETTING SOURCE SUMMARY® EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc.EDR Inc. 200 200 280 3 2 0 320 3 20 3 20 1 2 0 280 1 6160120 400 360 360 400 320 320 360320 280280 280 2 8 0280 2 8 0 2 8 0 320 280 280 280 3 6 0 320 280 2 8 0 200 2 0 0 120 120 1 2 0 1 2 0 1 2 0 1 20 1 2 0 1 2 0 1 2 0 2 4 0 2 4 0 2 4 0 2 4 0 240 24 0 240 240 240 240 2 4 0 2 0 0 2 0 0 200 200 200 2 0 0 2 0 0 2 002 0 0 20 0 2 00 160 1 6 0 160 1 6 0 160 160 1 6 0 160 160 1 60 1 6 0 160 1 6 0 MA TC4008590.2s Page A-8 1977-12-211.00 Date Feet below Surface Feet to Sealevel ------------------------------------------------- Ground-water levels, Number of Measurements: 1 ftWellholedepth units: 350Wellholedepth:ftWelldepth units: 350Welldepth:19771221Construction date: Not ReportedAquifer type: BedrockFormation type: Not ReportedAquifername: USCountrycode:NGVD29Vert coord refsys: Interpolated from topographic mapVertcollection method: feetVert accmeasure units: 03Vertacc measure val:feetVert measure units: 550.00Vert measure val:NAD83Horiz coord refsys: Interpolated from mapHoriz Collection method: secondsHoriz Acc measure units:1Horiz Acc measure: 24000Sourcemap scale:-72.6709243Longitude: 42.3012008Latitude:Not ReportedContrib drainagearea units: Not ReportedContrib drainagearea:Not ReportedDrainagearea Units: Not ReportedDrainagearea value:01080204Huc code: Not ReportedMonloc desc: WellMonloc type: MA-A5W 150Monloc name: USGS-421804072401701Monloc Identifier: USGS Massachusetts Water Science CenterFormal name: USGS-MAOrg. Identifier: 1West1/2 - 1 MileHigher USGS40000471739FED USGS Map IDDirectionDistanceElevation EDR ID NumberDatabase ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS® TC4008590.2s Page A-9 0%14%86%3.600 pCi/LBasement Not ReportedNot ReportedNot ReportedNot ReportedLiving Area - 2nd Floor Not ReportedNot ReportedNot ReportedNot ReportedLiving Area - 1st Floor % >20 pCi/L% 4-20 pCi/L% <4 pCi/LAverage ActivityArea Number of sites tested: 7 Federal Area Radon Information for Zip Code: 01060 : Zone 3 indoor average level < 2 pCi/L. : Zone 2 indoor average level >= 2 pCi/L and <= 4 pCi/L. Note: Zone 1 indoor average level > 4 pCi/L. Federal EPA Radon Zone for HAMPSHIRE County: 2 1.623HAMPSHIRE ____________________________ Median% of sites>4 pCi/LCounty Radon Test Results State Database: MA Radon AREA RADON INFORMATION ®GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS RADON ® TOPOGRAPHIC INFORMATION USGS 7.5’ Digital Elevation Model (DEM) Source: United States Geologic Survey EDR acquired the USGS 7.5’ Digital Elevation Model in 2002 and updated it in 2006. The 7.5 minute DEM corresponds to the USGS 1:24,000- and 1:25,000-scale topographic quadrangle maps. The DEM provides elevation data with consistent elevation units and projection. Scanned Digital USGS 7.5’ Topographic Map (DRG) Source: United States Geologic Survey A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images are made by scanning published paper maps on high-resolution scanners. The raster image is georeferenced and fit to the Universal Transverse Mercator (UTM) projection. HYDROLOGIC INFORMATION Flood Zone Data:This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA. NWI:National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002, 2005 and 2010 from the U.S. Fish and Wildlife Service. HYDROGEOLOGIC INFORMATION AQUIFLOW Information SystemR Source: EDR proprietary database of groundwater flow information EDR has developed the AQUIFLOW Information System (AIS) to provide data on the general direction of groundwater flow at specific points. EDR has reviewed reports submitted to regulatory authorities at select sites and has extracted the date of the report, hydrogeologically determined groundwater flow direction and depth to water table information. GEOLOGIC INFORMATION Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology of the Conterminous U.S. at 1:2,500,000 Scale - A digital representation of the 1974 P.B. King and H.M. Beikman Map, USGS Digital Data Series DDS - 11 (1994). STATSGO:State Soil Geographic Database Source: Department of Agriculture, Natural Resources Conservation Services The U.S. Department of Agriculture’s (USDA) Natural Resources Conservation Service (NRCS) leads the national Conservation Soil Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO) soil survey maps. SSURGO: Soil Survey Geographic Database Source: Department of Agriculture, Natural Resources Conservation Services (NRCS) Telephone: 800-672-5559 SSURGO is the most detailed level of mapping done by the Natural Resources Conservation Services, mapping scales generally range from 1:12,000 to 1:63,360. Field mapping methods using national standards are used to construct the soil maps in the Soil Survey Geographic (SSURGO) database. SSURGO digitizing duplicates the original soil survey maps. This level of mapping is designed for use by landowners, townships and county natural resource planning and management. TC4008590.2s Page PSGR-1 PHYSICAL SETTING SOURCE RECORDS SEARCHED LOCAL / REGIONAL WATER AGENCY RECORDS FEDERAL WATER WELLS PWS:Public Water Systems Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Public Water System data from the Federal Reporting Data System. A PWS is any water system which provides water to at least 25 people for at least 60 days annually. PWSs provide water from wells, rivers and other sources. PWS ENF:Public Water Systems Violation and Enforcement Data Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Violation and Enforcement data for Public Water Systems from the Safe Drinking Water Information System (SDWIS) after August 1995. Prior to August 1995, the data came from the Federal Reporting Data System (FRDS). USGS Water Wells: USGS National Water Inventory System (NWIS) This database contains descriptive information on sites where the USGS collects or has collected data on surface water and/or groundwater. The groundwater data includes information on wells, springs, and other sources of groundwater. STATE RECORDS Massachusetts Geographic Information System (MassGIS) Datalayers Source: Executive Office of Environmental Affairs Public Water Supply Database:The Public Water Supply datalayer contains the locations of public community surface and groundwater supply sources and public non-community supply sources as defined in 310 CMR 22.00. OTHER STATE DATABASE INFORMATION Areas of Critical Environmental Concern Datalayer:The Areas of Critical Environmental Concern (ACEC) datalayer shows the location of areas that have been designated ACECs by the Secretary of Environmental Affairs. ACEC designation requires greater environmental review of certain kinds of proposed development under state jurisdiction within the ACEC boundaries. The ACEC Program is administered by the Department of Environmental Management (DEM) on behalf of the Secretary of Environmental Affairs. The Massachusetts Coastal Zone Management (MCZM) Office managed the original Coastal ACEC Program from 1978 to 1993, and continues to play a key role in monitoring coastal ACECs. Procedures for ACEC designation and the general policies governing the effects of designation are contained in the ACEC regulations (301 CMR 12.00). The ACEC datalayer has been compiled by MCZM and DEM and includes both coastal and inland areas. EPA Designated Sole Source Aquifers Datalayer:The Sole Source Aquifer datalayer was compiled by the Department of Environmental Protection (DEP) Division of Water Supply (DWS). Seven Sole Source Aquifers have been designated by the US Environmental Protection Agency (EPA) for Massachusetts. A Sole Source Aquifer (SSA) is an aquifer designated by US EPA as the sole or principal source of drinking water for a given aquifer service area; that is, an aquifer which is needed to supply 50% or more of the drinking water for that area and for which there are no reasonably available alternative sources should that aquifer become contaminated. The aquifers were defined by a EPA hydrogeologist. Aquifers Datalayer:MassGIS produced an aquifer datalayer composed of 20 individual panels, generally based on the boundaries of the major drainage basins. Areas of high and medium yield were mapped. This datalayer includes polygon attribute coding to help in the identification of areas in which cleanup of hazardous waste sites must meet drinking water standards, as defined in the Massachusetts Contingency Plan (MCP) (310 CMR 40.00000). Non-Potential Drinking Water Source Areas:Non-Potential Drinking Water Source Areas (NPDWSA) are regulatory in nature, representing one of many considerations used in determining the standards to which ground water must be cleaned in the event of a release of oil or hazardous material. NPDWSAs are not based on existing water quality and do not indicate poor ambient conditions. TC4008590.2s Page PSGR-2 PHYSICAL SETTING SOURCE RECORDS SEARCHED DEP Approved Zone IIs Datalayer:The Department of Environmental Protection (DEP) approved Zone IIs datalayer was compiled by the DEP Division of Water Supply (DWS). The database contains 281 approved Zone IIs statewide. As stated in 310 CMR 22.02, a Zone II is "that area of an aquifer which contributes water to a well under the most severe pumping and recharge conditions that can be realistically anticipated (180 days of pumping at safe yield, with no recharge from precipitation.) It is bounded by the groundwater divides which result from pumping the well and by the contact of the aquifer with less permeable materials such as till or bedrock. In some cases, streams or lakes may act as recharge boundaries. In all cases, Zone IIs shall extend up gradient to its point of intersection with prevailing hydrogeologic boundaries (a groundwater flow divide, a contact with till or bedrock, or a recharge boundary)." These data are used in association with the Public Water Supplies datalayer. The following describes certain unique features of this association. - Any proposed new well which will pump at least 100,000 gallons per day must have a Zone II delineation completed and approved by DEP prior to the well coming on line. - Additionally, a new source may not be on-line yet, but other, older wells may fall within its Zone II boundary. - Further, existing wells must have a Zone II delineated as a condition of receiving a water withdrawal permit under the Water Management Act. RADON State Database: MA Radon Source: Department of Health Telephone: 413-586-7525 Radon Test Results Area Radon Information Source: USGS Telephone: 703-356-4020 The National Radon Database has been developed by the U.S. Environmental Protection Agency (USEPA) and is a compilation of the EPA/State Residential Radon Survey and the National Residential Radon Survey. The study covers the years 1986 - 1992. Where necessary data has been supplemented by information collected at private sources such as universities and research institutions. EPA Radon Zones Source: EPA Telephone: 703-356-4020 Sections 307 & 309 of IRAA directed EPA to list and identify areas of U.S. with the potential for elevated indoor radon levels. OTHER Airport Landing Facilities:Private and public use landing facilities Source: Federal Aviation Administration, 800-457-6656 Epicenters:World earthquake epicenters, Richter 5 or greater Source: Department of Commerce, National Oceanic and Atmospheric Administration Earthquake Fault Lines:The fault lines displayed on EDR’s Topographic map are digitized quaternary faultlines, prepared in 1975 by the United State Geological Survey STREET AND ADDRESS INFORMATION © 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material. TC4008590.2s Page PSGR-3 PHYSICAL SETTING SOURCE RECORDS SEARCHED ('5+LVWRULFDO7RSRJUDSKLF0DS5HSRUW 128 Rocky Hill Road 128 Rocky Hill Road Northampton, MA 01060 Inquiry Number: 4008590.4 July 16, 2014 EDR Historical Topographic Map Report Environmental Data Resources, Inc.s (EDR) Historical Topographic Map Report is designed to assist professionals in evaluating potential liability on a target property resulting from past activities. EDRs Historical Topographic Map Report includes a search of a collection of public and private color historical topographic maps, dating back to the early 1900s. Thank you for your business.Please contact EDR at 1-800-352-0050with any questions or comments. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALLENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report AS IS. Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should theybe interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2014 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. Historical Topographic Map →N TARGET QUADTARGET QUAD NAME:NORTHAMPTON MAP YEAR:1886 SERIES:15 SCALE:1:62500 SITE NAME:128 Rocky Hill Road ADDRESS:128 Rocky Hill Road Northampton, MA 01060 LAT/LONG:42.3026 / -72.6596 CLIENT:O'Reilly, Talbot & Okun CONTACT:Sabrina Moreau INQUIRY#:4008590.4 RESEARCH DATE:07/16/2014 Historical Topographic Map →N TARGET QUADTARGET QUAD NAME:NORTHAMPTON MAP YEAR:1895 SERIES:15 SCALE:1:62500 SITE NAME:128 Rocky Hill Road ADDRESS:128 Rocky Hill Road Northampton, MA 01060 LAT/LONG:42.3026 / -72.6596 CLIENT:O'Reilly, Talbot & Okun CONTACT:Sabrina Moreau INQUIRY#:4008590.4 RESEARCH DATE:07/16/2014 Historical Topographic Map →N TARGET QUADTARGET QUAD NAME:HOLYOKE MAP YEAR:1901 SERIES:30 SCALE:1:125000 SITE NAME:128 Rocky Hill Road ADDRESS:128 Rocky Hill Road Northampton, MA 01060 LAT/LONG:42.3026 / -72.6596 CLIENT:O'Reilly, Talbot & Okun CONTACT:Sabrina Moreau INQUIRY#:4008590.4 RESEARCH DATE:07/16/2014 Historical Topographic Map →N TARGET QUADTARGET QUAD NAME:EASTHAMPTON MAP YEAR:1948 SERIES:7.5 SCALE:1:24000 SITE NAME:128 Rocky Hill Road ADDRESS:128 Rocky Hill Road Northampton, MA 01060 LAT/LONG:42.3026 / -72.6596 CLIENT:O'Reilly, Talbot & Okun CONTACT:Sabrina Moreau INQUIRY#:4008590.4 RESEARCH DATE:07/16/2014 Historical Topographic Map →N TARGET QUADTARGET QUAD NAME:EASTHAMPTON MAP YEAR:1949 REVISED FROM :1939 SERIES:7.5 SCALE:1:31680 SITE NAME:128 Rocky Hill Road ADDRESS:128 Rocky Hill Road Northampton, MA 01060 LAT/LONG:42.3026 / -72.6596 CLIENT:O'Reilly, Talbot & Okun CONTACT:Sabrina Moreau INQUIRY#:4008590.4 RESEARCH DATE:07/16/2014 Historical Topographic Map →N TARGET QUADTARGET QUAD NAME:EASTHAMPTON MAP YEAR:1964 SERIES:7.5 SCALE:1:24000 SITE NAME:128 Rocky Hill Road ADDRESS:128 Rocky Hill Road Northampton, MA 01060 LAT/LONG:42.3026 / -72.6596 CLIENT:O'Reilly, Talbot & Okun CONTACT:Sabrina Moreau INQUIRY#:4008590.4 RESEARCH DATE:07/16/2014 Historical Topographic Map →N TARGET QUADTARGET QUAD NAME:EASTHAMPTON MAP YEAR:1979 PHOTOREVISED FROM :1964 SERIES:7.5 SCALE:1:25000 SITE NAME:128 Rocky Hill Road ADDRESS:128 Rocky Hill Road Northampton, MA 01060 LAT/LONG:42.3026 / -72.6596 CLIENT:O'Reilly, Talbot & Okun CONTACT:Sabrina Moreau INQUIRY#:4008590.4 RESEARCH DATE:07/16/2014 &HUWLILHG6DQERUQŠ0DS5HSRUW 128 Rocky Hill Road 128 Rocky Hill Road Northampton, MA 01060 Inquiry Number: 4008590.3 July 16, 2014 Certified Sanborn® Map Report 7/16/14 Site Name: 128 Rocky Hill Road 128 Rocky Hill Road Northampton, MA 01060 Client Name: O'Reilly, Talbot & Okun 293 Bridge Street Springfield, MA 01103 Contact:Sabrina MoreauEDR Inquiry #4008590.3 The Sanborn Library has been searched by EDR and maps covering the target property location as provided by O'Reilly, Talbot & Okun were identified for the years listed below. The Sanborn Library is the largest, most complete collection of fire insurance maps. The collection includes maps from Sanborn, Bromley, Perris & Browne, Hopkins, Barlow, and others. Only Environmental Data Resources Inc. (EDR) is authorized to grant rights for commercial reproduction of maps by the Sanborn Library LLC, the copyright holder for the collection. Results can be authenticated by visiting www.edrnet.com/sanborn. The Sanborn Library is continually enhanced with newly identified map archives. This report accesses all maps in the collection as of the day this report was generated. Certified Sanborn Results: Site Name:128 Rocky Hill Road Address:128 Rocky Hill Road City, State, Zip:Northampton, MA 01060 Cross Street: P.O. #NA Project:0285-22-01 Certification #7EDD-4AD1-9FB8 Library of Congress University Publications of America EDR Private Collection The Sanborn Library LLC Since 1866™ The Sanborn Library includes more than 1.2 million fire insurance maps from Sanborn, Bromley, Perris & Browne, Hopkins, Barlow and others which track historical property usage in approximately 12,000 American cities and towns. Collections searched: Sanborn® Library search results Certification # 7EDD-4AD1-9FB8 UNMAPPED PROPERTY This report certifies that the complete holdings of the Sanborn Library, LLC collection have been searched based on client supplied target property information, and fire insurance maps covering the target property were not found. Limited Permission To Make Copies O'Reilly, Talbot & Okun (the client) is permitted to make up to FIVE photocopies of this Sanborn Map transmittal and each fire insurance map accompanying this report solely for the limited use of its customer. No one other than the client is authorized to make copies. Upon request made directly to an EDR Account Executive, the client may be permitted to make a limited number of additional photocopies. This permission is conditioned upon compliance by the client, its customer and their agents with EDR's copyright policy; a copy of which is available upon request. Disclaimer - Copyright and Trademark notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OFERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL,INCIDENTAL CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLYLIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risklevels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providingany facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by anenvironmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2014 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. 4008590 - 3 page 2 7KH('5$HULDO3KRWR'HFDGH3DFNDJH 128 Rocky Hill Road 128 Rocky Hill Road Northampton, MA 01060 Inquiry Number: 4008590.9 July 17, 2014 EDR Aerial Photo Decade Package Environmental Data Resources, Inc. (EDR) Aerial Photo Decade Package is a screening tool designed to assist environmental professionals in evaluating potential liability on a target property resulting from past activities. EDR’s professional researchers provide digitally reproduced historical aerial photographs, and when available, provide one photo per decade. When delivered electronically by EDR, the aerial photo images included with this report are for ONE TIME USE ONLY. Further reproduction of these aerial photo images is prohibited without permission from EDR. For more information contact your EDR Account Executive. Thank you for your business.Please contact EDR at 1-800-352-0050with any questions or comments. Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALLENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report AS IS. Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should theybe interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice. Copyright 2014 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission. EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners. Date EDR Searched Historical Sources: Aerial Photography July 17, 2014 Target Property: 128 Rocky Hill Road Northampton, MA 01060 Year Scale Details Source 1962Aerial Photograph. Scale: 1"=500'Panel #: 42072-C6, Easthampton, MA;/Flight Date: April 21, 1962EDR 1972Aerial Photograph. Scale: 1"=1000'Panel #: 42072-C6, Easthampton, MA;/Flight Date: May 13, 1972EDR 1980Aerial Photograph. Scale: 1"=1000'Panel #: 42072-C6, Easthampton, MA;/Flight Date: April 03, 1980EDR 1990Aerial Photograph. Scale: 1"=500'Panel #: 42072-C6, Easthampton, MA;/Flight Date: May 03, 1990EDR 1995Aerial Photograph. Scale: 1"=500'Panel #: 42072-C6, Easthampton, MA;/DOQQ - acquisition dates: April 25, 1995 EDR 2006Aerial Photograph. Scale: 1"=500'Panel #: 42072-C6, Easthampton, MA;/Flight Year: 2006EDR 2008Aerial Photograph. Scale: 1"=500'Panel #: 42072-C6, Easthampton, MA;/Flight Year: 2008EDR 2010Aerial Photograph. Scale: 1"=500'Panel #: 42072-C6, Easthampton, MA;/Flight Year: 2010EDR 2012Aerial Photograph. Scale: 1"=500'Panel #: 42072-C6, Easthampton, MA;/Flight Year: 2012EDR 4008590.9 2 INQUIRY #: YEAR: 4008590.9 1962 = 500' INQUIRY #: YEAR: 4008590.9 1972 = 1000' INQUIRY #: YEAR: 4008590.9 1980 = 1000' INQUIRY #: YEAR: 4008590.9 1990 = 500' INQUIRY #: YEAR: 4008590.9 1995 = 500' INQUIRY #: YEAR: 4008590.9 2006 = 500' INQUIRY #: YEAR: 4008590.9 2008 = 500' INQUIRY #: YEAR: 4008590.9 2010 = 500' INQUIRY #: YEAR: 4008590.9 2012 = 500' 5RFN\+LOO5RDG 5RFN\+LOO5RDG 1RUWKDPSWRQ0$ ,QTXLU\1XPEHU -XO\ 7KH('5&LW\'LUHFWRU\,PDJH5HSRUW $UPVWURQJ5RDG 6KHOWRQ&7 ZZZHGUQHWFRP(QYLURQPHQWDO'DWD5HVRXUFHV,QF(QYLURQPHQWDO'DWD5HVRXUFHV,QF(QYLURQPHQWDO'DWD5HVRXUFHV,QF(QYLURQPHQWDO'DWD5HVRXUFHV,QF 7$%/(2)&217(176 6(&7,21 ([HFXWLYH6XPPDU\ )LQGLQJV &LW\'LUHFWRU\,PDJHV 7KDQN\RXIRU\RXUEXVLQHVV 3OHDVHFRQWDFW('5DW ZLWKDQ\TXHVWLRQVRUFRPPHQWV 'LVFODLPHU&RS\ULJKWDQG7UDGHPDUN1RWLFH 7KLV5HSRUWFRQWDLQVFHUWDLQLQIRUPDWLRQREWDLQHGIURPDYDULHW\RISXEOLFDQGRWKHUVRXUFHVUHDVRQDEO\DYDLODEOHWR (QYLURQPHQWDO'DWD5HVRXUFHV,QF,WFDQQRWEHFRQFOXGHGIURPWKLV5HSRUWWKDWFRYHUDJHLQIRUPDWLRQIRUWKHWDUJHWDQG VXUURXQGLQJSURSHUWLHVGRHVQRWH[LVWIURPRWKHUVRXUFHV12:$55$17<(;35(66('25,03/,(',60$'( :+$762(9(5,1&211(&7,21:,7+7+,65(3257(19,5210(17$/'$7$5(6285&(6,1&63(&,),&$//< ',6&/$,067+(0$.,1*2)$1<68&+:$55$17,(6,1&/8',1*:,7+287/,0,7$7,210(5&+$17$%,/,7< 25),71(66)25$3$57,&8/$586(25385326($//5,6.,6$6680('%<7+(86(5,112(9(176+$// (19,5210(17$/'$7$5(6285&(6,1&%(/,$%/(72$1<21(:+(7+(5$5,6,1*2872)(5525625 20,66,2161(*/,*(1&($&&,'(1725$1<27+(5&$86()25$1</26625'$0$*(,1&/8',1* :,7+287/,0,7$7,2163(&,$/,1&,'(17$/&216(48(17,$/25(;(03/$5<'$0$*(6$1</,$%,/,7<21 7+(3$572)(19,5210(17$/'$7$5(6285&(6,1&,6675,&7/</,0,7('72$5()81'2)7+($02817 3$,')257+,65(32573XUFKDVHUDFFHSWVWKLV5HSRUW$6,6$Q\DQDO\VHVHVWLPDWHVUDWLQJVHQYLURQPHQWDOULVN OHYHOVRUULVNFRGHVSURYLGHGLQWKLV5HSRUWDUHSURYLGHGIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWLQWHQGHGWRSURYLGHQRU VKRXOGWKH\EHLQWHUSUHWHGDVSURYLGLQJDQ\IDFWVUHJDUGLQJRUSUHGLFWLRQRUIRUHFDVWRIDQ\HQYLURQPHQWDOULVNIRUDQ\ SURSHUW\2QO\D3KDVH,(QYLURQPHQWDO6LWH$VVHVVPHQWSHUIRUPHGE\DQHQYLURQPHQWDOSURIHVVLRQDOFDQSURYLGH LQIRUPDWLRQUHJDUGLQJWKHHQYLURQPHQWDOULVNIRUDQ\SURSHUW\$GGLWLRQDOO\WKHLQIRUPDWLRQSURYLGHGLQWKLV5HSRUWLVQRWWR EHFRQVWUXHGDVOHJDODGYLFH &RS\ULJKWE\(QYLURQPHQWDO'DWD5HVRXUFHV,QF$OOULJKWVUHVHUYHG5HSURGXFWLRQLQDQ\PHGLDRUIRUPDWLQZKROHRULQ SDUWRIDQ\UHSRUWRUPDSRI(QYLURQPHQWDO'DWD5HVRXUFHV,QFRULWVDIILOLDWHVLVSURKLELWHGZLWKRXWSULRUZULWWHQSHUPLVVLRQ ('5DQGLWVORJRV LQFOXGLQJ6DQERUQDQG6DQERUQ0DS DUHWUDGHPDUNVRI(QYLURQPHQWDO'DWD5HVRXUFHV,QFRULWVDIILOLDWHV $OORWKHUWUDGHPDUNVXVHGKHUHLQDUHWKHSURSHUW\RIWKHLUUHVSHFWLYHRZQHUV (;(&87,9(6800$5< '(6&5,37,21 (QYLURQPHQWDO'DWD5HVRXUFHV,QF¶V ('5 &LW\'LUHFWRU\5HSRUWLVDVFUHHQLQJWRROGHVLJQHGWRDVVLVW HQYLURQPHQWDOSURIHVVLRQDOVLQHYDOXDWLQJSRWHQWLDOOLDELOLW\RQDWDUJHWSURSHUW\UHVXOWLQJIURPSDVWDFWLYLWLHV ('5¶V&LW\'LUHFWRU\5HSRUWLQFOXGHVDVHDUFKRIDYDLODEOHFLW\GLUHFWRU\GDWDDW\HDULQWHUYDOV 5(6($5&+6800$5< 7KHIROORZLQJUHVHDUFKVRXUFHVZHUHFRQVXOWHGLQWKHSUHSDUDWLRQRIWKLVUHSRUW$FKHFNPDUNLQGLFDWHV ZKHUHLQIRUPDWLRQZDVLGHQWLILHGLQWKHVRXUFHDQGSURYLGHGLQWKLVUHSRUW <HDU 7DUJHW6WUHHW &URVV6WUHHW 6RXUFH &ROH,QIRUPDWLRQ6HUYLFHV &ROH,QIRUPDWLRQ6HUYLFHV &ROH,QIRUPDWLRQ6HUYLFHV &ROH,QIRUPDWLRQ6HUYLFHV -RKQVRQ V&LW\'LUHFWRU\ 3ULFH /HH V&LW\'LUHFWRU\ 3ULFH /HH V&LW\'LUHFWRU\ 3ULFH /HH V&LW\'LUHFWRU\ 5(&25'6285&(6 ('5LVOLFHQVHGWRUHSURGXFHFHUWDLQ&LW\'LUHFWRU\ZRUNVE\WKHFRS\ULJKWKROGHUVRIWKRVHZRUNV7KH SXUFKDVHURIWKLV('5&LW\'LUHFWRU\5HSRUWPD\LQFOXGHLWLQUHSRUW V GHOLYHUHGWRDFXVWRPHU 5HSURGXFWLRQRI&LW\'LUHFWRULHVZLWKRXWSHUPLVVLRQRIWKHSXEOLVKHURUOLFHQVHGYHQGRUPD\EHDYLRODWLRQRI FRS\ULJKW 3DJH ),1',1*6 7$5*(73523(57<675((7 5RFN\+LOO5RDG 1RUWKDPSWRQ0$ <HDU &',PDJH 6RXUFH 52&.<+,//5' SJ$&ROH,QIRUPDWLRQ6HUYLFHV SJ$&ROH,QIRUPDWLRQ6HUYLFHV SJ$&ROH,QIRUPDWLRQ6HUYLFHV SJ$&ROH,QIRUPDWLRQ6HUYLFHV SJ$-RKQVRQ V&LW\'LUHFWRU\ SJ$3ULFH /HH V&LW\'LUHFWRU\ SJ$3ULFH /HH V&LW\'LUHFWRU\ SJ$3ULFH /HH V&LW\'LUHFWRU\ SJ$3ULFH /HH V&LW\'LUHFWRU\ 3DJH ),1',1*6 &5266675((76 <HDU &',PDJH 6RXUFH ($67+$037215' SJ$&ROH,QIRUPDWLRQ6HUYLFHV SJ$&ROH,QIRUPDWLRQ6HUYLFHV SJ$&ROH,QIRUPDWLRQ6HUYLFHV SJ$&ROH,QIRUPDWLRQ6HUYLFHV SJ$-RKQVRQ V&LW\'LUHFWRU\ SJ$3ULFH /HH V&LW\'LUHFWRU\ SJ$3ULFH /HH V&LW\'LUHFWRU\ SJ$3ULFH /HH V&LW\'LUHFWRU\ 3DJH City Directory Images - ROCKY HILL RD Cole Information Services 4008590.5 Page: A1 SourceTarget Street Cross Street 2013 46JOHN KOLOSKI 170KENNETH HATT 186OCCUPANT UNKNOWN 188KYLE ALAMED OCCUPANT UNKNOWN ROBERT BROOKS 205COMMONWEALTH OF MASSACHUSETTS HAMPSHIRE COUNTY OF JAIL SEE MASSACH 206BARBARA PABON J FROST JULIAN PAGACZ TIMOTHY CLARK 208FRANCIS BARBOUR 220PETER KAKOS 266SARAH TOURJEE 271CHRIST UNITED METHODIST CHURCH 275JOEL GUILLEMETTE 278DAVID PATRIQUIN 283DIAMANTE KUON SAYVUN SUON 286ADAM WILLIAMS 305JEANNE POPIOLEK 306GEORGE ADAMS 307JOSEPH POPIOLEK - EASTHAMPTON RD Cole Information Services 4008590.5 Page: A2 SourceTarget Street Cross Street 2013 1SEARLES AUTO PARTS 8BECKER & CUMPIANO STRINGED INSTRUMEN RICHARDS PLUMBING & HEATING 14AFFORDABLE USED CARS 54RACING MART 85SEARLES AUTO RECYCLING 149PHILLIPS ENTERPRISES INC 234VALLEY RECYCLING 309JOSEPH MONSKA 321CAROLINE RANGER 376ERNIES TOWING GREGS AUTO REPAIR P & D AUTO 474WILSON SERVICES 492ALBERT LONG 551R LUCIA 557DANCES WITH DOGS DAY CARE PAWSITIVELY DUNN PET GROOMING SHOPPE - ROCKY HILL RD Cole Information Services 4008590.5 Page: A3 SourceTarget Street Cross Street 2008 133C DWYER 142DAVID NELSON 170KENNETH HATT 186ANDREW SEK 188OCCUPANT UNKNOWN ROBERT BROOKS 206JULIAN PAGACZ OCCUPANT UNKNOWN S CHHOM 208FRANCIS BARBOUR 220PETER KAKOS 266IRAQI CHILDRENS PROJECT INC MICHAEL TOURJEE 275CHRIST UNITED METHODIST CHURCH PETER HEY 278DAVID PATRIQUIN 283DIAMANTE KUON OCCUPANT UNKNOWN 286DOUGLAS WILLIAMS 305JEANNE POPIOLEK 306VALORIE PENNINGTON 307JOSEPH POPIOLEK - EASTHAMPTON RD Cole Information Services 4008590.5 Page: A4 SourceTarget Street Cross Street 2008 8ARTISAN FRETTED INSTR REPR LEEDS GUITARMKRS PAYNE PETER REMODELING CENTER CB S PETER PAYNE TREEFROG LANDSCAPES INC 10EZ RIDER MOTORSPORT 14AFFORDABLE USED CARS K & P AUTOMOTIVE 15MARY STMARIE 85SEARLES AUTO RECYCLING 88EDWARD SZADO 115OCCUPANT UNKNOWN 149PHILLIPS ENTERPRISES 234TOMRA EAST NORTHAMPTON MASS FACILITY 309JOSEPH MONSKA 321JULIANA HASKELL 492CALVIN LONG 504ROLANDS MOTOR WORKS 551R LUCIA 557DANCES WITH DOGS DAY CARE HAMPSHIRE ACTION COMMISION INC THE COLLARED SCHOLAR - ROCKY HILL RD Cole Information Services 4008590.5 Page: A5 SourceTarget Street Cross Street 2003 142DAVID NELSON 170DAVID RACHMACIEJ 186ANDREW SEK GREEN MILL LANDSCAPING 188RALPH CHALLET ROBERT BROOKS 206JULIAN PAGACZ OCCUPANT UNKNOWN 208FRANCIS BARBOUR 220PETER KAKOS 266JEFFREY MORRISSEY 275CHRIST UNITED METHODIST CHURCH OCCUPANT UNKNOWN 278DAVID PATRIQUIN 283CHY CHEN 286DOUGLAS WILLIAMS 305JOSEPH POPIOLEK 306RICHARD WHITE - EASTHAMPTON RD Cole Information Services 4008590.5 Page: A6 SourceTarget Street Cross Street 2003 8IVON SCHMUKLER NICKERSON GUITARS PAYNE PETER A CBNT SHOP CARP WM R CUMPIANO GUITA 10OCCUPANT UNKNOWN U HAUL CO 14K & P AUTOMOTIVE OCCUPANT UNKNOWN 15MARY STMARIE 54NORTHAMPTON CITGO 85TAD WEISS 88EDWARD SZADO 109GERARD RONAN 115OCCUPANT UNKNOWN 149PHILLIPS ENTERPRISES INC TRACY MESSINA 254JOSEPH GREGOIRE 309JOSEPH MONSKA 376ERNIES TOWING GREGS AUTO REPAIR WAYSIDE AUTO BODY 492CALVIN LONG 504DONALD ASHTON ROLANDS MOTOR WORKS 551R LUCIA 557UNITED WAY - ROCKY HILL RD Cole Information Services 4008590.5 Page: A7 SourceTarget Street Cross Street 1999 93RICHARD LAU 128SANDYS SPEED EQUIP 170DEBORAH RACHMACIEJ KENNETH HATT 186ALISHA MCMORROW ANDREW SEK S GREENBERG 188ROBERT BROOKS 205MASS COMMONWEALTH OF PAROLE BD 206OCCUPANT UNKNOWN 208FRANCIS BARBOUR 220VANESSA LAFFERT 266K MORRISSEY 271CHRIST UNITED METHODIST CHURCH STUDY METHODIST CHURCH CHRIST UNI 275CHRIST UNITED METHODIST CHURCH 278CARL GLOWATSKY 283JEANNE POPIOLEK 286DOUGLAS WILLIAMS 305HUBERT ROWLAND 306A SCHRATER RICHARD WHITE ROBERT SCHRATTER - EASTHAMPTON RD Cole Information Services 4008590.5 Page: A8 SourceTarget Street Cross Street 1999 8ARTISAN FRETTED INSTRUMENT REPAIR BY IVON SCHMUKLER CUMPIANO WILLIAM R STRINGFELLOW GUITARS HWANG CARLOS GUITARS IVON SCHMUKLER LEEDS GUITARMAKERS WORKSHOP NICKERSON GUITARS PAYNE PETER A CARP 10NORTHAMPTON OUTDOOR POWER 14HAMPTON EQUIPMENT K & P AUTOMOTIVE RED AUTOMOTIVE 309ANITA MONSKA 321ELECTRICAL SERVICES INCORPORATED 376ERNIES TOWING GREGS AUTO REPAIR TRUCKS UNLIMITED WAYSIDE AUTO BODY WAYSIDE AUTO RENTAL 504ROLANDS MOTOR WORKS - ROCKY HILL RD Johnson's City Directory 4008590.5 Page: A9 SourceTarget Street Cross Street 1990 - EASTHAMPTON RD Johnson's City Directory 4008590.5 Page: A10 SourceTarget Street Cross Street 1990 - ROCKY HILL RD Price & Lee's City Directory 4008590.5 Page: A11 SourceTarget Street Cross Street 1977 - ROCKY HILL RD Price & Lee's City Directory 4008590.5 Page: A12 SourceTarget Street Cross Street 1977 - EASTHAMPTON RD Price & Lee's City Directory 4008590.5 Page: A13 SourceTarget Street Cross Street 1977 - ROCKY HILL RD Price & Lee's City Directory 4008590.5 Page: A14 SourceTarget Street Cross Street 1970 - EASTHAMPTON RD Price & Lee's City Directory 4008590.5 Page: A15 SourceTarget Street Cross Street 1970 - ROCKY HILL RD Price & Lee's City Directory 4008590.5 Page: A16 SourceTarget Street Cross Street 1963 - EASTHAMPTON RD Price & Lee's City Directory 4008590.5 Page: A17 SourceTarget Street Cross Street 1963                  $33(1',;( (35,25,7<5(6285&(60$3  Phase 1 Site Assessment Map: 500 feet & 0.5 Mile Radii Site Information: 128 ROCKY HILL ROAD NORTHAMPTON, MA NAD83 UTM Meters:4686032mN , 692974mE (Zone: 18)July 16, 2014 The information shown is the best available at thedate of printing. However, it may be incomplete. Theresponsible party and LSP are ultimatelyresponsible for ascertaining the true conditionssurrounding the site. Metadata for data layersshown on this map can be found at:http://www.mass.gov/mgis/. 500 m 1000 ft MassDEP Phase 1 Site Assessment Maphttp://maps.massgis.state.ma.us/images/dep/mcp/mcp.htm 1 of 1 7/16/2014 5:09 PM                  $33(1',;) 6,7(5(&211$,66$1&()250   Page 1 of 4 O’Reilly, Talbot & Okun Associates, Inc. ASTM E1527-05 Site Reconnaissance Form Site Name and Address: Lots 37-049 and 37-062 128 Rocky Hill Road and Easthampton Road Northampton, Massachusetts Date of Visit: July 24, 2014 O’Reilly, Talbot & Okun Associates, Inc. Representative: Sabrina Moreau Key Site Manager: Carol Hewes, Owner __________________________________________________________ GENERAL SITE SETTING Current and past uses of the Property likely to indicate or known to have recognized environmental conditions (RECs); None Identified Current and past uses of adjoining properties likely to indicate or known to have recognized environmental conditions (RECs); None Identified Current and past uses of the surrounding area; Residential, undeveloped wooded, protected open space (fields), bike path, Fuel oil storage area (north of Site), recycling center and transfer station (opposite side of Easthampton Road) Geologic, hydro-geologic, hydrologic and topographic conditions of the property; and of the surrounding area. General topography slopes down to the southeast Structures on the property (number, size and age). 1 wood framed, 10 foot by 10 foot bulding, windows boarded up. Constructed in 1953 (per assessors card) Page 2 of 4 2 fenced buildings used as pump houses to pressurize subsurface natural gas utility (located within an easement and land-locked parcel NOT PART OF THE SITE). Overhead transmission lines, also located within an easement. Roads on or adjoining the property. Gravel covered access road from Rocky Hill Road to pump house buildings located centrally on the Site. Rocky Hill Road to the north. Easthampton Road to the southeast of the Site. Source of potable water on the property. Available in streets of Rocky Hill Road and Easthampton Road. Sewage disposal system on the property (type and age) Available in streets of Rocky Hill Road and Easthampton Road. INTERIOR AND EXTERIOR OBSERVATIONS Current and past uses of the interior and exterior of the subject property. Identify general uses and any that may involve hazardous materials or petroleum products. If current uses involve hazardous materials or petroleum products, identify the type, quantity and storage conditions of those substances. Identify unoccupied occupant spaces Past uses of the property Current uses- Undeveloped woodland with easements, Past uses- No available records available for Sandy’s Speed Equipment Hazardous substances and Petroleum Products in Connection with Identified Uses None Identified Aboveground and underground storage tanks, including contents, capacity and age. Identify visible vent pipes, fill pipes, and access ways. None Identified Noxious odors, pools of liquid, and note any standing surface water. None Identified Drums, contents of drums and other containers. None Identified Page 3 of 4 Hazardous substance and petroleum products containers None Identified Unidentified substance containers None Identified Electrical or hydraulic equipment likely to contain PCBs. Pole mounted transformers observed on Site, PCB contents unknown. INTERIOR OBSERVATIONS **Buildings was not accessible. Type of HVAC system and fuel source. NA Stains, molds and/or corrosion on floors, walls or ceilings. NA Drains and sumps (pits, cisterns, cesspools or similar receptacles where liquids drain, collect or are stored). NA EXTERIOR OBSERVATIONS Pits, ponds and lagoons (open pools) likely to contain hazardous substance or petroleum products, particularly if used in connection with waste disposal or waste treatment on the property and on adjoining properties. None Identified Stained soil or pavement. None Identified Stressed vegetation. None Identified Solid waste disposal on site, Unnatural fill or grading, particularly fill of unknown origin. See below. Page 4 of 4 Trash or other evidence of solid waste disposal. Body of a 1940s automobile observed in the northern portion of the Site. Wastewater (including stormwater) discharges into a drain, ditch or stream on the property and on adjacent property. None Identified Dry wells, irrigation wells, injection wells, abandoned wells, monitoring wells, supply wells, or other wells. None Identified On-site septic system or cesspool. None Identified Areas likely to be considered wetlands and state open waters. None Identified Other unusual conditions that may be of concern. None Identified F:\Admin\Field Forms\ASTM E1527-00 Forms\Site Reconnaisance.doc                  $33(1',;* 2:1(5,17(59,(:)250   Page 1 of 3 2¶5HLOO\7DOERW 2NXQ$VVRFLDWHV,QF $670( ,QWHUYLHZ)RUP    6LWH1DPHDQG$GGUHVV/RW 5RFN\+LOO5RDG DQG/RW (DVWKDPSWRQ5RDG LQ1RUWKDPSWRQ0DVVDFKXVHWWV   'DWHRI,QWHUYLHZ7XHVGD\-XO\   2ZQHU0UV&DURO+HZHV  BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  3URSHUW\GHVFULSWLRQ/DQGDUHDFXUUHQWDQGIRUPHUODQGXVHQXPEHURIEXLOGLQJVDJH RIEXLOGLQJVKHDWLQJVRXUFHIRUEXLOGLQJVDYDLODEOHXWLOLWLHV  5RFN\+LOO5RDG±DFUHVPRUHRUOHVV±XQGHYHORSHGODQGVXEMHFWWR0DVV (OHFWULF&RPSDQ\HDVHPHQW7HQQHFR,QFHDVHPHQWDQG%HUNVKLUH*DV&RHDVHPHQW DVUHFRUGHGLQWKH+DPSVKLUH&RXQW\5HJLVWU\RI'HHGV  (DVWKDPSWRQ5RDG±DFUHVPRUHRUOHVV±XQGHYHORSHGODQG   'R\RXNQRZRIDQ\«  SULRUHQYLURQPHQWDOVLWHDVVHVVPHQWUHSRUWV"  1RQHWRWKHEHVWRIP\NQRZOHGJH   HQYLURQPHQWDODXGLWUHSRUWV"  1RQHWRWKHEHVWRIP\NQRZOHGJH   HQYLURQPHQWDOSHUPLWV"  1RQHWRWKHEHVWRIP\NQRZOHGJH   FXUUHQWDQGRUIRUPHUXQGHUJURXQGDQGRUDERYHJURXQGVWRUDJHWDQNV"  1RQHWRWKHEHVWRIP\NQRZOHGJH  Page 2 of 3 1RWLFHVRIYLRODWLRQVIURPJRYHUQPHQWDJHQFLHV"  1RQHWRWKHEHVWRIP\NQRZOHGJH   1RWLILFDWLRQVDQGUHSRUWVUHJDUGLQJKD]DUGRXVZDVWHJHQHUDWLRQ  1RQHWRWKHEHVWRIP\NQRZOHGJH   x3HQGLQJWKUHDWHQHGRUSDVWOLWLJDWLRQUHJDUGLQJKD]DUGRXVVXEVWDQFHVRU SHWUROHXPSURGXFWVLQRQRUIURPWKHSURSHUW\  1RQHWRWKHEHVWRIP\NQRZOHGJH   x3HQGLQJWKUHDWHQHGRUSDVWDGPLQLVWUDWLYHSURFHHGLQJVUHJDUGLQJKD]DUGRXV VXEVWDQFHVRUSHWUROHXPSURGXFWVLQRQRUIURPWKHSURSHUW\  1RQHWRWKHEHVWRIP\NQRZOHGJH   x1RWLFHVIURPDQ\JRYHUQPHQWHQWLW\UHJDUGLQJDQ\SRVVLEOHYLRODWLRQRI HQYLURQPHQWDOODZVRUSRVVLEOHOLDELOLW\UHODWLQJWRKD]DUGRXVVXEVWDQFHV  1RQHWRWKHEHVWRIP\NQRZOHGJH   6SLOOVRUUHOHDVHVRIKD]DUGRXVZDVWHRUSHWUROHXPSURGXFWV"  1RQHWRWKHEHVWRIP\NQRZOHGJH   7UDQVIRUPHUVRQ6LWH",IVRDJH"3&%FRQWHQW"  7KHUHLVD0DVVDFKXVHWWV(OHFWULF&RPSDQ\HDVHPHQWRYHUDSRUWLRQRIWKHSDUFHODW 5RFN\+LOO5RDGEXW,GRQRWNQRZLIWKHUHDUHWUDQVIRUPHUVRQVLWHWKHLUDJHRU SRWHQWLDO3&%FRQWHQW            Page 3 of 3   7KLVIRUPZDVFRPSOHWHGEDVHGRQDWHOHSKRQHFRQYHUVDWLRQRQ-XO\ ZLWK0UV&DURO+HZHV:HUHYLHZHGWKHTXHVWLRQVWRJHWKHUDQG,FRPSOHWHGWKHIRUP EDVHGXSRQKHUDQVZHUV    'DWHGBBBBBBBBBBBBBBBBBBBBBBBBBBBB %UDG$6KLPHO(VTXLUH :LOKHOP6KLPHO .LQJ .LQJ6WUHHW 1RUWKDPSWRQ0$   $WWRUQH\IRU0UV&DURO+HZHV     F:\Admin\Field Forms\ASTM E1527-00 Forms\Interview Form.doc